Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF83_RS00710 Genome accession   NZ_CP094078
Coordinates   148950..149075 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe101     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 143950..154075
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF83_RS00685 (MPF83_00685) - 144010..146232 (+) 2223 WP_245054167.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF83_RS00690 (MPF83_00690) panD 146222..146572 (+) 351 WP_245054169.1 aspartate 1-decarboxylase -
  MPF83_RS00695 (MPF83_00695) - 146583..146876 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPF83_RS00700 (MPF83_00700) - 146876..147871 (+) 996 WP_245054805.1 PDZ domain-containing protein -
  MPF83_RS00705 (MPF83_00705) comB6 147879..148934 (+) 1056 WP_245054170.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF83_RS00710 (MPF83_00710) comB7 148950..149075 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPF83_RS00715 (MPF83_00715) comB8 149072..149815 (+) 744 WP_245054173.1 virB8 family protein Machinery gene
  MPF83_RS00720 (MPF83_00720) comB9 149815..150780 (+) 966 WP_245054175.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF83_RS00725 (MPF83_00725) comB10 150773..151909 (+) 1137 WP_245054177.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF83_RS00730 (MPF83_00730) - 151979..153391 (+) 1413 WP_245054179.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574181 MPF83_RS00710 WP_001217874.1 148950..149075(+) (comB7) [Helicobacter pylori strain Hpfe101]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574181 MPF83_RS00710 WP_001217874.1 148950..149075(+) (comB7) [Helicobacter pylori strain Hpfe101]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878