Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG62_RS00705 Genome accession   NZ_CP094071
Coordinates   149008..149133 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe106     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144008..154133
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG62_RS00680 (MPG62_00680) - 144070..146292 (+) 2223 WP_245099445.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG62_RS00685 (MPG62_00685) panD 146282..146632 (+) 351 WP_245099447.1 aspartate 1-decarboxylase -
  MPG62_RS00690 (MPG62_00690) - 146643..146936 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG62_RS00695 (MPG62_00695) - 146936..147931 (+) 996 WP_245099449.1 PDZ domain-containing protein -
  MPG62_RS00700 (MPG62_00700) comB6 147937..148992 (+) 1056 WP_245100069.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG62_RS00705 (MPG62_00705) comB7 149008..149133 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG62_RS00710 (MPG62_00710) - 149130..149874 (+) 745 Protein_139 virB8 family protein -
  MPG62_RS00715 (MPG62_00715) comB9 149874..150857 (+) 984 WP_245099451.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG62_RS00720 (MPG62_00720) comB10 150850..151986 (+) 1137 WP_245099453.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG62_RS00725 (MPG62_00725) - 152056..153468 (+) 1413 WP_245099454.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574020 MPG62_RS00705 WP_001217874.1 149008..149133(+) (comB7) [Helicobacter pylori strain Hpfe106]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574020 MPG62_RS00705 WP_001217874.1 149008..149133(+) (comB7) [Helicobacter pylori strain Hpfe106]
ATGAGAATTTTTTTTGTCATAATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACGTTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878