Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG33_RS00685 Genome accession   NZ_CP094070
Coordinates   148500..148625 (+) Length   41 a.a.
NCBI ID   WP_024117273.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe107     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 143500..153625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG33_RS00660 (MPG33_00660) - 143560..145782 (+) 2223 WP_245062826.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG33_RS00665 (MPG33_00665) panD 145772..146122 (+) 351 WP_180478221.1 aspartate 1-decarboxylase -
  MPG33_RS00670 (MPG33_00670) - 146133..146426 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG33_RS00675 (MPG33_00675) - 146426..147421 (+) 996 WP_245063234.1 PDZ domain-containing protein -
  MPG33_RS00680 (MPG33_00680) comB6 147429..148484 (+) 1056 WP_154450108.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG33_RS00685 (MPG33_00685) comB7 148500..148625 (+) 126 WP_024117273.1 hypothetical protein Machinery gene
  MPG33_RS00690 (MPG33_00690) comB8 148622..149365 (+) 744 WP_156584896.1 virB8 family protein Machinery gene
  MPG33_RS00695 (MPG33_00695) comB9 149365..150336 (+) 972 WP_245062828.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG33_RS00700 (MPG33_00700) comB10 150329..151465 (+) 1137 WP_245062830.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG33_RS00705 (MPG33_00705) - 151531..152943 (+) 1413 WP_245062832.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4752.75 Da        Isoelectric Point: 9.3278

>NTDB_id=573979 MPG33_RS00685 WP_024117273.1 148500..148625(+) (comB7) [Helicobacter pylori strain Hpfe107]
MRIFSVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573979 MPG33_RS00685 WP_024117273.1 148500..148625(+) (comB7) [Helicobacter pylori strain Hpfe107]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829