Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG37_RS00735 Genome accession   NZ_CP094064
Coordinates   154862..154987 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe114     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 149862..159987
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG37_RS00710 (MPG37_00710) - 149922..152144 (+) 2223 WP_245051201.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG37_RS00715 (MPG37_00715) panD 152134..152484 (+) 351 WP_180461662.1 aspartate 1-decarboxylase -
  MPG37_RS00720 (MPG37_00720) - 152495..152788 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG37_RS00725 (MPG37_00725) - 152788..153783 (+) 996 WP_245051718.1 PDZ domain-containing protein -
  MPG37_RS00730 (MPG37_00730) comB6 153791..154846 (+) 1056 WP_245051720.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG37_RS00735 (MPG37_00735) comB7 154862..154987 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG37_RS00740 (MPG37_00740) comB8 154984..155727 (+) 744 WP_140563071.1 virB8 family protein Machinery gene
  MPG37_RS00745 (MPG37_00745) comB9 155727..156689 (+) 963 WP_245051203.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG37_RS00750 (MPG37_00750) comB10 156682..157818 (+) 1137 WP_245051204.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG37_RS00755 (MPG37_00755) - 157888..159300 (+) 1413 WP_245051209.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=573816 MPG37_RS00735 WP_001217874.1 154862..154987(+) (comB7) [Helicobacter pylori strain Hpfe114]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573816 MPG37_RS00735 WP_001217874.1 154862..154987(+) (comB7) [Helicobacter pylori strain Hpfe114]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878