Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG68_RS00705 Genome accession   NZ_CP094063
Coordinates   146202..146327 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe115     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 141202..151327
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG68_RS00680 (MPG68_00680) - 141253..143475 (+) 2223 WP_245026838.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG68_RS00685 (MPG68_00685) panD 143465..143815 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG68_RS00690 (MPG68_00690) - 143862..144119 (+) 258 WP_245027498.1 YbaB/EbfC family nucleoid-associated protein -
  MPG68_RS00695 (MPG68_00695) - 144119..145123 (+) 1005 WP_245027499.1 PDZ domain-containing protein -
  MPG68_RS00700 (MPG68_00700) comB6 145131..146186 (+) 1056 WP_245027500.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG68_RS00705 (MPG68_00705) comB7 146202..146327 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG68_RS00710 (MPG68_00710) comB8 146324..147067 (+) 744 WP_128018270.1 virB8 family protein Machinery gene
  MPG68_RS00715 (MPG68_00715) comB9 147067..148029 (+) 963 WP_245026840.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG68_RS00720 (MPG68_00720) comB10 148022..149158 (+) 1137 WP_245026842.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG68_RS00725 (MPG68_00725) - 149224..150636 (+) 1413 WP_245026844.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=573772 MPG68_RS00705 WP_001217874.1 146202..146327(+) (comB7) [Helicobacter pylori strain Hpfe115]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573772 MPG68_RS00705 WP_001217874.1 146202..146327(+) (comB7) [Helicobacter pylori strain Hpfe115]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878