Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG08_RS00700 Genome accession   NZ_CP094058
Coordinates   150318..150443 (+) Length   41 a.a.
NCBI ID   WP_245042433.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe123     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145318..155443
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG08_RS00675 (MPG08_00675) - 145378..147600 (+) 2223 WP_245042429.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG08_RS00680 (MPG08_00680) panD 147590..147940 (+) 351 WP_245042431.1 aspartate 1-decarboxylase -
  MPG08_RS00685 (MPG08_00685) - 147951..148244 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG08_RS00690 (MPG08_00690) - 148244..149239 (+) 996 WP_245042946.1 PDZ domain-containing protein -
  MPG08_RS00695 (MPG08_00695) comB6 149247..150302 (+) 1056 WP_245042432.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG08_RS00700 (MPG08_00700) comB7 150318..150443 (+) 126 WP_245042433.1 comB7 lipoprotein Machinery gene
  MPG08_RS00705 (MPG08_00705) comB8 150440..151177 (+) 738 WP_245042435.1 virB8 family protein Machinery gene
  MPG08_RS00710 (MPG08_00710) comB9 151177..152139 (+) 963 WP_245042436.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG08_RS00715 (MPG08_00715) comB10 152132..153268 (+) 1137 WP_245042437.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG08_RS00720 (MPG08_00720) - 153335..154747 (+) 1413 WP_245042438.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=573608 MPG08_RS00700 WP_245042433.1 150318..150443(+) (comB7) [Helicobacter pylori strain Hpfe123]
MRISFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573608 MPG08_RS00700 WP_245042433.1 150318..150443(+) (comB7) [Helicobacter pylori strain Hpfe123]
ATGAGAATCTCTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854