Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF85_RS00680 Genome accession   NZ_CP094054
Coordinates   146504..146629 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe125     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 141504..151629
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF85_RS00655 (MPF85_00655) - 141555..143777 (+) 2223 WP_245013584.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF85_RS00660 (MPF85_00660) panD 143767..144117 (+) 351 WP_245013585.1 aspartate 1-decarboxylase -
  MPF85_RS00665 (MPF85_00665) - 144128..144421 (+) 294 WP_245013586.1 YbaB/EbfC family nucleoid-associated protein -
  MPF85_RS00670 (MPF85_00670) - 144421..145425 (+) 1005 WP_245013902.1 PDZ domain-containing protein -
  MPF85_RS00675 (MPF85_00675) comB6 145433..146488 (+) 1056 WP_245013903.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF85_RS00680 (MPF85_00680) comB7 146504..146629 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPF85_RS00685 (MPF85_00685) comB8 146626..147363 (+) 738 WP_245013587.1 virB8 family protein Machinery gene
  MPF85_RS00690 (MPF85_00690) comB9 147363..148325 (+) 963 WP_245013588.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF85_RS00695 (MPF85_00695) comB10 148318..149454 (+) 1137 WP_050850644.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF85_RS00700 (MPF85_00700) - 149524..150936 (+) 1413 WP_245013589.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=573529 MPF85_RS00680 WP_001217874.1 146504..146629(+) (comB7) [Helicobacter pylori strain Hpfe125]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573529 MPF85_RS00680 WP_001217874.1 146504..146629(+) (comB7) [Helicobacter pylori strain Hpfe125]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878