Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG10_RS00780 Genome accession   NZ_CP094051
Coordinates   156934..157059 (+) Length   41 a.a.
NCBI ID   WP_024117273.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe127     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 151934..162059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG10_RS00755 (MPG10_00755) - 151996..154218 (+) 2223 WP_245061319.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG10_RS00760 (MPG10_00760) panD 154208..154558 (+) 351 WP_245061320.1 aspartate 1-decarboxylase -
  MPG10_RS00765 (MPG10_00765) - 154569..154862 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG10_RS00770 (MPG10_00770) - 154862..155857 (+) 996 WP_245061321.1 PDZ domain-containing protein -
  MPG10_RS00775 (MPG10_00775) comB6 155863..156918 (+) 1056 WP_245061873.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG10_RS00780 (MPG10_00780) comB7 156934..157059 (+) 126 WP_024117273.1 hypothetical protein Machinery gene
  MPG10_RS00785 (MPG10_00785) comB8 157056..157799 (+) 744 WP_245061322.1 virB8 family protein Machinery gene
  MPG10_RS00790 (MPG10_00790) comB9 157799..158764 (+) 966 WP_245061323.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG10_RS00795 (MPG10_00795) comB10 158757..159893 (+) 1137 WP_245061324.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG10_RS00800 (MPG10_00800) - 159963..161375 (+) 1413 WP_245061325.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4752.75 Da        Isoelectric Point: 9.3278

>NTDB_id=573444 MPG10_RS00780 WP_024117273.1 156934..157059(+) (comB7) [Helicobacter pylori strain Hpfe127]
MRIFSVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573444 MPG10_RS00780 WP_024117273.1 156934..157059(+) (comB7) [Helicobacter pylori strain Hpfe127]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAATTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829