Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   MO978_RS11215 Genome accession   NZ_CP093959
Coordinates   2212465..2212749 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis strain FAM 17919     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2207465..2217749
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MO978_RS11185 (MO978_11175) - 2207889..2208266 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  MO978_RS11190 (MO978_11180) - 2208470..2209336 (+) 867 WP_003129984.1 RluA family pseudouridine synthase -
  MO978_RS11195 (MO978_11185) - 2209375..2210184 (-) 810 WP_014570791.1 metal ABC transporter permease -
  MO978_RS11200 (MO978_11190) - 2210177..2210914 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  MO978_RS11205 (MO978_11195) - 2211091..2211933 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  MO978_RS11210 (MO978_11200) - 2211930..2212367 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  MO978_RS11215 (MO978_11205) comGG 2212465..2212749 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  MO978_RS11220 (MO978_11210) comGF 2212788..2213234 (-) 447 WP_289421826.1 competence type IV pilus minor pilin ComGF Machinery gene
  MO978_RS11225 (MO978_11215) comGE 2213197..2213493 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  MO978_RS11230 (MO978_11220) comGD 2213465..2213896 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  MO978_RS11235 (MO978_11225) comGC 2213856..2214124 (-) 269 Protein_2186 competence type IV pilus major pilin ComGC -
  MO978_RS11245 (MO978_11235) - 2214878..2215657 (-) 780 WP_373961894.1 peptidoglycan amidohydrolase family protein -
  MO978_RS11250 (MO978_11240) - 2215657..2215956 (-) 300 WP_010905918.1 phage holin -
  MO978_RS11255 (MO978_11245) - 2215969..2216319 (-) 351 WP_373961895.1 hypothetical protein -
  MO978_RS11260 (MO978_11250) - 2216332..2216553 (-) 222 WP_031561031.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=573122 MO978_RS11215 WP_003129993.1 2212465..2212749(-) (comGG) [Lactococcus lactis strain FAM 17919]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=573122 MO978_RS11215 WP_003129993.1 2212465..2212749(-) (comGG) [Lactococcus lactis strain FAM 17919]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAACAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585