Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | KM132_RS15345 | Genome accession | NZ_CP076119 |
| Coordinates | 3122015..3122155 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain NZ4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3117015..3127155
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM132_RS15320 (KM132_15320) | - | 3117355..3117738 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| KM132_RS15325 (KM132_15325) | comA | 3117760..3118404 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| KM132_RS15330 (KM132_15330) | comP | 3118485..3120776 (-) | 2292 | WP_099721970.1 | histidine kinase | Regulator |
| KM132_RS15335 (KM132_15335) | comX | 3120788..3120952 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| KM132_RS15340 (KM132_15340) | - | 3120952..3121830 (-) | 879 | WP_032860494.1 | polyprenyl synthetase family protein | - |
| KM132_RS15345 (KM132_15345) | degQ | 3122015..3122155 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| KM132_RS15350 (KM132_15350) | - | 3122621..3122962 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| KM132_RS15355 (KM132_15355) | - | 3122969..3124192 (-) | 1224 | WP_154817913.1 | EAL and HDOD domain-containing protein | - |
| KM132_RS15360 (KM132_15360) | - | 3124322..3125788 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| KM132_RS15365 (KM132_15365) | - | 3125806..3126357 (-) | 552 | WP_154817914.1 | isochorismatase family cysteine hydrolase | - |
| KM132_RS15370 (KM132_15370) | - | 3126454..3126852 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=572133 KM132_RS15345 WP_003152043.1 3122015..3122155(-) (degQ) [Bacillus velezensis strain NZ4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=572133 KM132_RS15345 WP_003152043.1 3122015..3122155(-) (degQ) [Bacillus velezensis strain NZ4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |