Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KM132_RS15345 Genome accession   NZ_CP076119
Coordinates   3122015..3122155 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NZ4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3117015..3127155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM132_RS15320 (KM132_15320) - 3117355..3117738 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  KM132_RS15325 (KM132_15325) comA 3117760..3118404 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  KM132_RS15330 (KM132_15330) comP 3118485..3120776 (-) 2292 WP_099721970.1 histidine kinase Regulator
  KM132_RS15335 (KM132_15335) comX 3120788..3120952 (-) 165 WP_007613432.1 competence pheromone ComX -
  KM132_RS15340 (KM132_15340) - 3120952..3121830 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  KM132_RS15345 (KM132_15345) degQ 3122015..3122155 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KM132_RS15350 (KM132_15350) - 3122621..3122962 (+) 342 WP_014418765.1 hypothetical protein -
  KM132_RS15355 (KM132_15355) - 3122969..3124192 (-) 1224 WP_154817913.1 EAL and HDOD domain-containing protein -
  KM132_RS15360 (KM132_15360) - 3124322..3125788 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  KM132_RS15365 (KM132_15365) - 3125806..3126357 (-) 552 WP_154817914.1 isochorismatase family cysteine hydrolase -
  KM132_RS15370 (KM132_15370) - 3126454..3126852 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=572133 KM132_RS15345 WP_003152043.1 3122015..3122155(-) (degQ) [Bacillus velezensis strain NZ4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=572133 KM132_RS15345 WP_003152043.1 3122015..3122155(-) (degQ) [Bacillus velezensis strain NZ4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891