Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KH238_RS13105 Genome accession   NZ_CP076045
Coordinates   2720673..2720813 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain VCN56     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2715673..2725813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH238_RS13080 (KH238_13080) - 2716019..2716402 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  KH238_RS13085 (KH238_13085) comA 2716424..2717068 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KH238_RS13090 (KH238_13090) comP 2717149..2719449 (-) 2301 WP_032867184.1 histidine kinase Regulator
  KH238_RS13095 (KH238_13095) comX 2719463..2719636 (-) 174 WP_012118314.1 competence pheromone ComX -
  KH238_RS13100 (KH238_13100) - 2719605..2720465 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  KH238_RS13105 (KH238_13105) degQ 2720673..2720813 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KH238_RS13110 (KH238_13110) - 2721279..2721620 (+) 342 WP_007408677.1 hypothetical protein -
  KH238_RS13115 (KH238_13115) - 2721627..2722850 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  KH238_RS13120 (KH238_13120) - 2722980..2724446 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  KH238_RS13125 (KH238_13125) - 2724464..2725015 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KH238_RS13130 (KH238_13130) - 2725112..2725510 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=571632 KH238_RS13105 WP_003152043.1 2720673..2720813(-) (degQ) [Bacillus velezensis strain VCN56]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=571632 KH238_RS13105 WP_003152043.1 2720673..2720813(-) (degQ) [Bacillus velezensis strain VCN56]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891