Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   MNY35_RS16085 Genome accession   NZ_CP093298
Coordinates   3353173..3353349 (+) Length   58 a.a.
NCBI ID   WP_007408675.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MN-13     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3348173..3358349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNY35_RS16060 (MNY35_16045) - 3348331..3349797 (+) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  MNY35_RS16065 (MNY35_16050) - 3349927..3351150 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  MNY35_RS16070 (MNY35_16055) - 3351157..3351498 (-) 342 WP_015418107.1 hypothetical protein -
  MNY35_RS16075 (MNY35_16060) degQ 3351964..3352104 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MNY35_RS16080 (MNY35_16065) comQ 3352235..3353173 (+) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  MNY35_RS16085 (MNY35_16070) comX 3353173..3353349 (+) 177 WP_007408675.1 competence pheromone ComX Regulator
  MNY35_RS16090 (MNY35_16075) comP 3353369..3355678 (+) 2310 WP_033574914.1 histidine kinase Regulator
  MNY35_RS16095 (MNY35_16080) comA 3355759..3356403 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  MNY35_RS16100 (MNY35_16085) - 3356425..3356808 (+) 384 WP_007408674.1 hotdog fold thioesterase -
  MNY35_RS16105 (MNY35_16090) mnhG 3356848..3357222 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  MNY35_RS16110 (MNY35_16095) - 3357206..3357490 (-) 285 WP_012118311.1 Na(+)/H(+) antiporter subunit F1 -
  MNY35_RS16115 (MNY35_16100) - 3357490..3357966 (-) 477 WP_007408672.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6644.64 Da        Isoelectric Point: 4.6082

>NTDB_id=571244 MNY35_RS16085 WP_007408675.1 3353173..3353349(+) (comX) [Bacillus amyloliquefaciens strain MN-13]
MQDLINYILKYPEVLKKLKVNEASLLGYDSGITQILINSFEESSIVKNDGKIEQWEKG

Nucleotide


Download         Length: 177 bp        

>NTDB_id=571244 MNY35_RS16085 WP_007408675.1 3353173..3353349(+) (comX) [Bacillus amyloliquefaciens strain MN-13]
ATGCAGGATTTAATCAATTATATATTGAAATATCCGGAAGTGTTAAAAAAATTAAAAGTCAATGAAGCAAGTTTATTAGG
CTATGATTCAGGTATTACCCAAATATTAATCAATTCATTTGAAGAATCTTCAATTGTGAAAAACGATGGAAAAATAGAGC
AATGGGAAAAAGGATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

47.273

94.828

0.448