Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   MNY35_RS09350 Genome accession   NZ_CP093298
Coordinates   1964376..1964495 (-) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MN-13     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1959376..1969495
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNY35_RS09325 (MNY35_09320) - 1959619..1960377 (-) 759 Protein_1829 ABC transporter ATP-binding protein -
  MNY35_RS09330 (MNY35_09325) - 1960371..1961318 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  MNY35_RS09335 (MNY35_09330) ceuB 1961308..1962261 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  MNY35_RS09340 (MNY35_09335) - 1962675..1964039 (+) 1365 WP_033575080.1 aspartate kinase -
  MNY35_RS09345 (MNY35_09340) - 1964134..1964229 (+) 96 WP_076983091.1 YjcZ family sporulation protein -
  MNY35_RS09350 (MNY35_09345) phrC 1964376..1964495 (-) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  MNY35_RS09355 (MNY35_09350) rapC 1964479..1965627 (-) 1149 WP_033575082.1 Rap family tetratricopeptide repeat protein Regulator
  MNY35_RS09360 (MNY35_09355) - 1965780..1967213 (-) 1434 WP_015416810.1 HAMP domain-containing sensor histidine kinase -
  MNY35_RS09365 (MNY35_09360) - 1967200..1967883 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=571193 MNY35_RS09350 WP_033575081.1 1964376..1964495(-) (phrC) [Bacillus amyloliquefaciens strain MN-13]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=571193 MNY35_RS09350 WP_033575081.1 1964376..1964495(-) (phrC) [Bacillus amyloliquefaciens strain MN-13]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744