Detailed information    

insolico Bioinformatically predicted

Overview


Name   dinR/lexA   Type   Regulator
Locus tag   MN092_RS18795 Genome accession   NZ_CP093290
Coordinates   3644728..3644946 (-) Length   72 a.a.
NCBI ID   WP_011198294.1    Uniprot ID   Q65EU9
Organism   Bacillus licheniformis strain DSM 13     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context


Location: 3639728..3649946
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MN092_RS18770 (MN092_18770) - 3640112..3640972 (-) 861 WP_003185031.1 DMT family transporter -
  MN092_RS18775 (MN092_18775) - 3641003..3641386 (-) 384 WP_003185033.1 hypothetical protein -
  MN092_RS18780 (MN092_18780) - 3641975..3643096 (-) 1122 WP_003185035.1 RapH N-terminal domain-containing protein -
  MN092_RS18785 (MN092_18785) - 3643753..3643905 (+) 153 WP_176523208.1 hypothetical protein -
  MN092_RS18790 (MN092_18790) - 3643982..3644665 (+) 684 WP_073411941.1 hypothetical protein -
  MN092_RS18795 (MN092_18795) dinR/lexA 3644728..3644946 (-) 219 WP_011198294.1 transcriptional regulator Regulator
  MN092_RS18800 (MN092_18800) - 3645173..3645742 (+) 570 WP_011198295.1 hypothetical protein -
  MN092_RS18805 (MN092_18805) - 3645988..3646281 (-) 294 Protein_3674 peptidoglycan-binding domain-containing protein -
  MN092_RS18810 (MN092_18810) - 3646354..3647067 (-) 714 Protein_3675 N-acetylmuramoyl-L-alanine amidase -
  MN092_RS18815 (MN092_18815) - 3647120..3647383 (-) 264 WP_241876378.1 phage holin -
  MN092_RS18820 (MN092_18820) - 3647399..3647668 (-) 270 WP_069500916.1 hemolysin XhlA family protein -
  MN092_RS18825 (MN092_18825) - 3647731..3647916 (-) 186 WP_009329195.1 XkdX family protein -
  MN092_RS18830 (MN092_18830) - 3647913..3648236 (-) 324 WP_069500282.1 bZIP transcription factor -
  MN092_RS18835 (MN092_18835) - 3648249..3649688 (-) 1440 WP_241876379.1 BppU family phage baseplate upper protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8231.55 Da        Isoelectric Point: 10.2439

>NTDB_id=571111 MN092_RS18795 WP_011198294.1 3644728..3644946(-) (dinR/lexA) [Bacillus licheniformis strain DSM 13]
MKKSEQILEAIDELTKEKGFPPSVREIGERVGLKSSSTTKGHLDRLRKKGLVDWEEGKPRTLHILYKEKATI

Nucleotide


Download         Length: 219 bp        

>NTDB_id=571111 MN092_RS18795 WP_011198294.1 3644728..3644946(-) (dinR/lexA) [Bacillus licheniformis strain DSM 13]
ATGAAAAAATCCGAACAAATATTAGAAGCCATAGACGAACTAACTAAAGAAAAAGGTTTCCCGCCATCTGTTAGGGAAAT
AGGTGAAAGGGTTGGTTTAAAATCTTCAAGTACAACAAAAGGTCATCTTGACCGGTTGCGTAAAAAGGGGCTTGTTGATT
GGGAAGAAGGTAAGCCGAGAACATTGCATATTTTGTATAAAGAAAAAGCCACCATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q65EU9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

55.224

93.056

0.514