Detailed information NTG0571082

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: MN092_RS14790
• Genome accession: NZ_CP093290
• Coordinates: 2885691..2886128 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain DSM 13
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2880691..2891128

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MN092_RS14740 (MN092_14740)	sinI	2880866..2881042 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
MN092_RS14745 (MN092_14745)	sinR	2881076..2881411 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
MN092_RS14750 (MN092_14750)	tasA	2881516..2882310 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
MN092_RS14755 (MN092_14755)	sipW	2882384..2882968 (-)	585	WP_003183449.1	signal peptidase I SipW	-
MN092_RS14760 (MN092_14760)	tapA	2882965..2883693 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
MN092_RS14765 (MN092_14765)	-	2883970..2884290 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
MN092_RS14770 (MN092_14770)	-	2884314..2884496 (-)	183	WP_003183456.1	YqzE family protein	-
MN092_RS14775 (MN092_14775)	comGG	2884585..2884950 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
MN092_RS14780 (MN092_14780)	comGF	2884963..2885451 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
MN092_RS14785 (MN092_14785)	comGE	2885360..2885707 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
MN092_RS14790 (MN092_14790)	comGD	2885691..2886128 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
MN092_RS14795 (MN092_14795)	comGC	2886134..2886427 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
MN092_RS14800 (MN092_14800)	comGB	2886441..2887475 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
MN092_RS14805 (MN092_14805)	comGA	2887465..2888403 (-)	939	WP_061565980.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
MN092_RS14810 (MN092_14810)	-	2888560..2889399 (-)	840	WP_003183480.1	STAS domain-containing protein	-
MN092_RS14820 (MN092_14820)	-	2889641..2890018 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
MN092_RS14825 (MN092_14825)	-	2890227..2890472 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=571082 MN092_RS14790 WP_009327905.1 2885691..2886128(-) (comGD) [Bacillus licheniformis strain DSM 13]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=571082 MN092_RS14790 WP_009327905.1 2885691..2886128(-) (comGD) [Bacillus licheniformis strain DSM 13]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393