Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | KIL00_RS13905 | Genome accession | NZ_CP075344 |
| Coordinates | 2652004..2652414 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. subtilis strain A1 - Midalam | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2647371..2698858 | 2652004..2652414 | within | 0 |
Gene organization within MGE regions
Location: 2647371..2698858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIL00_RS13880 (KIL00_13880) | yqeF | 2647538..2648269 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| KIL00_RS13885 (KIL00_13885) | cwlH | 2648521..2649273 (-) | 753 | WP_069837642.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| KIL00_RS13890 (KIL00_13890) | yqeD | 2649460..2650086 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| KIL00_RS13895 (KIL00_13895) | gnd | 2650105..2650998 (-) | 894 | WP_069837643.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| KIL00_RS13900 (KIL00_13900) | yqeB | 2651249..2651971 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| KIL00_RS13905 (KIL00_13905) | nucA/comI | 2652004..2652414 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| KIL00_RS13910 (KIL00_13910) | - | 2652610..2652957 (+) | 348 | Protein_2702 | sigma-70 family RNA polymerase sigma factor | - |
| KIL00_RS13915 (KIL00_13915) | spoIVCA | 2652988..2654448 (-) | 1461 | WP_250629559.1 | site-specific DNA recombinase SpoIVCA | - |
| KIL00_RS22150 | - | 2654406..2654584 (-) | 179 | Protein_2704 | hypothetical protein | - |
| KIL00_RS13920 (KIL00_13920) | arsC | 2654939..2655358 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| KIL00_RS13925 (KIL00_13925) | acr3 | 2655370..2656410 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| KIL00_RS13930 (KIL00_13930) | yqcK | 2656433..2656873 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| KIL00_RS13935 (KIL00_13935) | arsR | 2656934..2657251 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| KIL00_RS13940 (KIL00_13940) | yqcI | 2657623..2658387 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| KIL00_RS13945 (KIL00_13945) | rapE | 2658830..2659957 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| KIL00_RS13950 (KIL00_13950) | phrE | 2659947..2660081 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| KIL00_RS13955 (KIL00_13955) | - | 2660191..2660349 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| KIL00_RS13960 (KIL00_13960) | yqcG | 2660719..2662314 (+) | 1596 | WP_213783410.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| KIL00_RS13965 (KIL00_13965) | yqcF | 2662329..2662907 (+) | 579 | Protein_2714 | type VII secretion system immunity protein YqcF | - |
| KIL00_RS13970 (KIL00_13970) | - | 2663025..2663171 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| KIL00_RS13975 (KIL00_13975) | - | 2663168..2663530 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| KIL00_RS13980 (KIL00_13980) | - | 2663546..2664025 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| KIL00_RS13985 (KIL00_13985) | cwlA | 2664190..2665008 (-) | 819 | WP_213783411.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KIL00_RS13990 (KIL00_13990) | yqxH | 2665053..2665475 (-) | 423 | WP_213783412.1 | holin family protein | - |
| KIL00_RS13995 (KIL00_13995) | yqxG | 2665520..2666413 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| KIL00_RS14000 (KIL00_14000) | yqcE | 2666501..2666665 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| KIL00_RS14005 (KIL00_14005) | yqcD | 2666662..2666997 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| KIL00_RS14010 (KIL00_14010) | yqcC | 2667007..2668107 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| KIL00_RS14015 (KIL00_14015) | - | 2668110..2668382 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| KIL00_RS14020 (KIL00_14020) | yqcA | 2668379..2668957 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| KIL00_RS14025 (KIL00_14025) | yqbT | 2668941..2669987 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| KIL00_RS14030 (KIL00_14030) | yqbS | 2669980..2670405 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| KIL00_RS14035 (KIL00_14035) | yqbR | 2670418..2670681 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| KIL00_RS14040 (KIL00_14040) | yqbQ | 2670678..2671658 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| KIL00_RS14045 (KIL00_14045) | yqbP | 2671671..2672330 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KIL00_RS14050 (KIL00_14050) | yqbO | 2672323..2677080 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| KIL00_RS14055 (KIL00_14055) | - | 2677083..2677220 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| KIL00_RS14060 (KIL00_14060) | - | 2677262..2677711 (-) | 450 | WP_213783413.1 | phage portal protein | - |
| KIL00_RS14065 (KIL00_14065) | txpA | 2677857..2678036 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| KIL00_RS14070 (KIL00_14070) | bsrH | 2678416..2678505 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| KIL00_RS14075 (KIL00_14075) | - | 2678759..2679202 (-) | 444 | WP_213783414.1 | phage tail tube protein | - |
| KIL00_RS14080 (KIL00_14080) | yqbK | 2679205..2680605 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| KIL00_RS14085 (KIL00_14085) | - | 2680606..2680797 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| KIL00_RS14090 (KIL00_14090) | yqbJ | 2680794..2681231 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| KIL00_RS14095 (KIL00_14095) | yqbI | 2681244..2681747 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| KIL00_RS14100 (KIL00_14100) | yqbH | 2681744..2682106 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| KIL00_RS14105 (KIL00_14105) | yqbG | 2682103..2682498 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| KIL00_RS14110 (KIL00_14110) | yqbF | 2682502..2682813 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| KIL00_RS14115 (KIL00_14115) | yqbE | 2682824..2683759 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| KIL00_RS14120 (KIL00_14120) | yqbD | 2683778..2684746 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| KIL00_RS14125 (KIL00_14125) | - | 2684779..2685432 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| KIL00_RS14130 (KIL00_14130) | yqbB | 2685473..2686390 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| KIL00_RS14135 (KIL00_14135) | yqbA | 2686387..2687919 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| KIL00_RS14140 (KIL00_14140) | yqaT | 2687923..2689218 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| KIL00_RS14145 (KIL00_14145) | terS | 2689211..2689925 (-) | 715 | Protein_2750 | phage terminase small subunit | - |
| KIL00_RS14150 (KIL00_14150) | - | 2689993..2690457 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| KIL00_RS14155 (KIL00_14155) | yqaQ | 2690601..2691056 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| KIL00_RS14160 (KIL00_14160) | - | 2691254..2692183 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| KIL00_RS14165 (KIL00_14165) | yqaO | 2692257..2692463 (-) | 207 | WP_213783415.1 | XtrA/YqaO family protein | - |
| KIL00_RS14170 (KIL00_14170) | yqaN | 2692545..2692973 (-) | 429 | WP_213783416.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KIL00_RS14175 (KIL00_14175) | - | 2693069..2693218 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| KIL00_RS14180 (KIL00_14180) | sknM | 2693209..2694150 (-) | 942 | WP_213783417.1 | ATP-binding protein | - |
| KIL00_RS14185 (KIL00_14185) | yqaL | 2694032..2694712 (-) | 681 | WP_213783645.1 | DnaD domain protein | - |
| KIL00_RS14190 (KIL00_14190) | yqaK | 2694788..2695642 (-) | 855 | WP_213783418.1 | recombinase RecT | - |
| KIL00_RS14195 (KIL00_14195) | yqaJ | 2695645..2696604 (-) | 960 | WP_213783419.1 | YqaJ viral recombinase family protein | - |
| KIL00_RS14200 (KIL00_14200) | - | 2696710..2696904 (-) | 195 | WP_213783420.1 | hypothetical protein | - |
| KIL00_RS14205 (KIL00_14205) | - | 2696864..2697037 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| KIL00_RS14210 (KIL00_14210) | sknH | 2697034..2697291 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| KIL00_RS14215 (KIL00_14215) | yqaG | 2697288..2697857 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| KIL00_RS14220 (KIL00_14220) | - | 2697931..2698071 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| KIL00_RS14225 (KIL00_14225) | yqaF | 2698101..2698331 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| KIL00_RS14230 (KIL00_14230) | sknR | 2698508..2698858 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=568932 KIL00_RS13905 WP_009967785.1 2652004..2652414(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=568932 KIL00_RS13905 WP_009967785.1 2652004..2652414(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |