Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MK848_RS04560 Genome accession   NZ_CP092824
Coordinates   937014..937187 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain S1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 932014..942187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK848_RS04545 (MK848_04550) gcvT 932813..933901 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  MK848_RS04550 (MK848_04555) hepAA 934343..936016 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  MK848_RS04555 (MK848_04560) yqhG 936037..936831 (+) 795 WP_003230200.1 YqhG family protein -
  MK848_RS04560 (MK848_04565) sinI 937014..937187 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MK848_RS04565 (MK848_04570) sinR 937221..937556 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MK848_RS04570 (MK848_04575) tasA 937649..938434 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MK848_RS04575 (MK848_04580) sipW 938498..939070 (-) 573 WP_003246088.1 signal peptidase I SipW -
  MK848_RS04580 (MK848_04585) tapA 939054..939815 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MK848_RS04585 (MK848_04590) yqzG 940087..940413 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MK848_RS04590 (MK848_04595) spoIITA 940455..940634 (-) 180 WP_003230176.1 YqzE family protein -
  MK848_RS04595 (MK848_04600) comGG 940705..941079 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MK848_RS04600 (MK848_04605) comGF 941080..941463 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MK848_RS04605 (MK848_04610) comGE 941489..941836 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=568347 MK848_RS04560 WP_003230187.1 937014..937187(+) (sinI) [Bacillus subtilis strain S1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=568347 MK848_RS04560 WP_003230187.1 937014..937187(+) (sinI) [Bacillus subtilis strain S1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1