Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KH277_RS04840 Genome accession   NZ_CP075054
Coordinates   948896..949036 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain VTX20     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 943896..954036
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH277_RS04815 (KH277_04815) - 944202..944600 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  KH277_RS04820 (KH277_04820) - 944697..945248 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KH277_RS04825 (KH277_04825) - 945266..946732 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KH277_RS04830 (KH277_04830) - 946862..948082 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  KH277_RS04835 (KH277_04835) - 948089..948430 (-) 342 WP_014305721.1 hypothetical protein -
  KH277_RS04840 (KH277_04840) degQ 948896..949036 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KH277_RS04845 (KH277_04845) - 949221..950099 (+) 879 WP_231040471.1 polyprenyl synthetase family protein -
  KH277_RS04850 (KH277_04850) comX 950099..950263 (+) 165 WP_007613432.1 competence pheromone ComX -
  KH277_RS04855 (KH277_04855) comP 950275..952566 (+) 2292 WP_014305719.1 histidine kinase Regulator
  KH277_RS04860 (KH277_04860) comA 952647..953291 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  KH277_RS04865 (KH277_04865) - 953313..953696 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=567453 KH277_RS04840 WP_003152043.1 948896..949036(+) (degQ) [Bacillus velezensis strain VTX20]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=567453 KH277_RS04840 WP_003152043.1 948896..949036(+) (degQ) [Bacillus velezensis strain VTX20]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891