Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MKS87_RS13430 Genome accession   NZ_CP092631
Coordinates   2578243..2578626 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain YB-15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2573243..2583626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKS87_RS13390 (MKS87_13390) sinI 2574176..2574349 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKS87_RS13395 (MKS87_13395) sinR 2574383..2574718 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKS87_RS13400 (MKS87_13400) tasA 2574811..2575596 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKS87_RS13405 (MKS87_13405) sipW 2575660..2576232 (-) 573 WP_003246088.1 signal peptidase I -
  MKS87_RS13410 (MKS87_13410) tapA 2576216..2576977 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKS87_RS13415 (MKS87_13415) yqzG 2577249..2577575 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKS87_RS13420 (MKS87_13420) spoIIT 2577617..2577796 (-) 180 WP_029726723.1 YqzE family protein -
  MKS87_RS13425 (MKS87_13425) comGG 2577868..2578242 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MKS87_RS13430 (MKS87_13430) comGF 2578243..2578626 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  MKS87_RS13435 (MKS87_13435) comGE 2578652..2578999 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  MKS87_RS13440 (MKS87_13440) comGD 2578983..2579414 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  MKS87_RS13445 (MKS87_13445) comGC 2579404..2579700 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  MKS87_RS13450 (MKS87_13450) comGB 2579714..2580751 (-) 1038 WP_173614185.1 comG operon protein ComGB Machinery gene
  MKS87_RS13455 (MKS87_13455) comGA 2580738..2581808 (-) 1071 WP_069322755.1 competence protein ComGA Machinery gene
  MKS87_RS13460 (MKS87_13460) corA 2582219..2583172 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=567372 MKS87_RS13430 WP_029317913.1 2578243..2578626(-) (comGF) [Bacillus subtilis strain YB-15]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=567372 MKS87_RS13430 WP_029317913.1 2578243..2578626(-) (comGF) [Bacillus subtilis strain YB-15]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976