Detailed information
Bioinformatically predicted
Overview
| Name | sxy/tfoX | Type | Regulator |
| Locus tag | KIL87_RS18860 | Genome accession | NZ_CP074998 |
| Coordinates | 3610100..3610729 (-) | Length | 209 a.a. |
| NCBI ID | WP_000839153.1 | Uniprot ID | A0A9Q6Y251 |
| Organism | Escherichia coli strain 6883 | ||
| Function | positive regulator of competence gene (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3584910..3623232 | 3610100..3610729 | within | 0 |
Gene organization within MGE regions
Location: 3584910..3623232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIL87_RS18655 (KIL87_18455) | - | 3585131..3585403 (-) | 273 | WP_001342259.1 | hypothetical protein | - |
| KIL87_RS18660 | - | 3585372..3585503 (-) | 132 | WP_001342258.1 | hypothetical protein | - |
| KIL87_RS18665 (KIL87_18460) | - | 3585539..3585796 (+) | 258 | WP_001260977.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| KIL87_RS18670 (KIL87_18465) | - | 3585802..3586101 (+) | 300 | WP_000220601.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KIL87_RS18675 (KIL87_18470) | - | 3586306..3586650 (-) | 345 | WP_000206830.1 | hypothetical protein | - |
| KIL87_RS18680 (KIL87_18475) | - | 3586647..3587012 (-) | 366 | WP_001229296.1 | HNH endonuclease | - |
| KIL87_RS18685 (KIL87_18480) | - | 3587014..3587232 (-) | 219 | WP_000209152.1 | DUF4014 family protein | - |
| KIL87_RS18690 (KIL87_18485) | - | 3587443..3587955 (-) | 513 | Protein_3672 | ead/Ea22-like family protein | - |
| KIL87_RS18695 (KIL87_18490) | - | 3587952..3588128 (-) | 177 | WP_000753069.1 | hypothetical protein | - |
| KIL87_RS18700 (KIL87_18495) | - | 3588121..3588303 (-) | 183 | WP_001224662.1 | DUF7167 family protein | - |
| KIL87_RS18705 (KIL87_18500) | - | 3588337..3588549 (-) | 213 | WP_000935422.1 | hypothetical protein | - |
| KIL87_RS18710 (KIL87_18505) | - | 3588600..3588956 (-) | 357 | WP_000403783.1 | hypothetical protein | - |
| KIL87_RS18715 (KIL87_18510) | - | 3588934..3589395 (-) | 462 | WP_001209480.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
| KIL87_RS18720 (KIL87_18515) | - | 3589392..3589688 (-) | 297 | WP_001266133.1 | DUF4406 domain-containing protein | - |
| KIL87_RS18725 (KIL87_18520) | - | 3589685..3590077 (-) | 393 | WP_001040234.1 | DUF977 family protein | - |
| KIL87_RS18730 (KIL87_18525) | - | 3590093..3590818 (-) | 726 | WP_000450641.1 | DUF1627 domain-containing protein | - |
| KIL87_RS18735 (KIL87_18530) | - | 3590852..3591313 (-) | 462 | WP_000139444.1 | replication protein P | - |
| KIL87_RS18740 (KIL87_18535) | - | 3591306..3592316 (-) | 1011 | WP_000729535.1 | DUF1376 domain-containing protein | - |
| KIL87_RS18745 (KIL87_18540) | - | 3592403..3592840 (-) | 438 | WP_000693932.1 | toxin YdaT family protein | - |
| KIL87_RS18750 (KIL87_18545) | - | 3592837..3593097 (-) | 261 | WP_001172789.1 | transcriptional regulator | - |
| KIL87_RS18755 (KIL87_18550) | - | 3593224..3593616 (+) | 393 | WP_000578360.1 | helix-turn-helix domain-containing protein | - |
| KIL87_RS18760 (KIL87_18555) | - | 3593663..3594022 (-) | 360 | WP_001022415.1 | helix-turn-helix domain-containing protein | - |
| KIL87_RS18765 (KIL87_18560) | - | 3594025..3594327 (-) | 303 | WP_000692026.1 | type II toxin-antitoxin system HigB family toxin | - |
| KIL87_RS18770 | - | 3594741..3594941 (-) | 201 | WP_024182289.1 | ECs_2282 family putative zinc-binding protein | - |
| KIL87_RS18775 (KIL87_18570) | ydfC | 3595034..3595252 (+) | 219 | WP_001171921.1 | protein YdfC | - |
| KIL87_RS18780 (KIL87_18575) | dicB | 3595821..3596009 (+) | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
| KIL87_RS18785 (KIL87_18580) | - | 3596006..3596194 (+) | 189 | WP_000199475.1 | DUF1482 family protein | - |
| KIL87_RS18790 (KIL87_18585) | - | 3596289..3598739 (+) | 2451 | WP_419775512.1 | 3'-5' exoribonuclease domain-containing protein | - |
| KIL87_RS18795 (KIL87_18590) | - | 3598807..3599049 (+) | 243 | WP_000273151.1 | DUF4224 domain-containing protein | - |
| KIL87_RS18800 (KIL87_18595) | - | 3599027..3600046 (+) | 1020 | WP_001299351.1 | tyrosine-type recombinase/integrase | - |
| KIL87_RS18805 (KIL87_18600) | yccA | 3600454..3601113 (+) | 660 | WP_000375138.1 | FtsH protease modulator YccA | - |
| KIL87_RS18810 (KIL87_18605) | tusE | 3601204..3601533 (+) | 330 | WP_000904442.1 | sulfurtransferase TusE | - |
| KIL87_RS18815 (KIL87_18610) | yccX | 3601530..3601808 (-) | 279 | WP_000048244.1 | acylphosphatase | - |
| KIL87_RS18820 (KIL87_18615) | rlmI | 3601903..3603093 (+) | 1191 | WP_000116301.1 | 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI | - |
| KIL87_RS18825 (KIL87_18620) | hspQ | 3603151..3603468 (+) | 318 | WP_001295356.1 | heat shock protein HspQ | - |
| KIL87_RS18830 (KIL87_18625) | yccU | 3603513..3603926 (-) | 414 | WP_000665217.1 | CoA-binding protein | - |
| KIL87_RS18835 (KIL87_18630) | csgI | 3604099..3604756 (+) | 658 | Protein_3701 | DUF2057 family protein | - |
| KIL87_RS18840 (KIL87_18635) | mgsA | 3604852..3605310 (+) | 459 | WP_000424181.1 | methylglyoxal synthase | - |
| KIL87_RS18845 (KIL87_18640) | helD | 3605342..3607396 (-) | 2055 | WP_001297106.1 | DNA helicase IV | - |
| KIL87_RS18850 (KIL87_18645) | yccF | 3607519..3607965 (+) | 447 | WP_001261235.1 | YccF domain-containing protein | - |
| KIL87_RS18855 (KIL87_18650) | yccS | 3607975..3610137 (+) | 2163 | WP_000875023.1 | YccS family putative transporter | - |
| KIL87_RS18860 (KIL87_18655) | sxy/tfoX | 3610100..3610729 (-) | 630 | WP_000839153.1 | CRP-S regulon transcriptional coactivator Sxy | Regulator |
| KIL87_RS18865 (KIL87_18660) | sulA | 3610948..3611457 (+) | 510 | WP_000288710.1 | SOS-induced cell division inhibitor SulA | - |
| KIL87_RS18870 (KIL87_18665) | ompA | 3611814..3612854 (+) | 1041 | WP_000750416.1 | porin OmpA | - |
| KIL87_RS18875 (KIL87_18670) | matP | 3612929..3613381 (-) | 453 | WP_000877161.1 | macrodomain Ter protein MatP | - |
| KIL87_RS18880 (KIL87_18675) | ycbZ | 3613567..3615327 (+) | 1761 | WP_000156528.1 | AAA family ATPase | - |
| KIL87_RS18885 (KIL87_18680) | fabA | 3615396..3615914 (+) | 519 | WP_000227927.1 | bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase | - |
| KIL87_RS18890 (KIL87_18685) | rmf | 3615984..3616151 (-) | 168 | WP_000828648.1 | ribosome modulation factor | - |
| KIL87_RS18895 (KIL87_18690) | pqiC | 3616407..3616970 (-) | 564 | WP_000759122.1 | membrane integrity-associated transporter subunit PqiC | - |
| KIL87_RS18900 (KIL87_18695) | pqiB | 3616967..3618607 (-) | 1641 | WP_000445533.1 | intermembrane transport protein PqiB | - |
| KIL87_RS18905 (KIL87_18700) | pqiA | 3618612..3619865 (-) | 1254 | WP_000333176.1 | membrane integrity-associated transporter subunit PqiA | - |
| KIL87_RS18910 (KIL87_18705) | uup | 3619995..3621902 (-) | 1908 | WP_000053122.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 209 a.a. Molecular weight: 24147.02 Da Isoelectric Point: 9.2180
>NTDB_id=567304 KIL87_RS18860 WP_000839153.1 3610100..3610729(-) (sxy/tfoX) [Escherichia coli strain 6883]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
Nucleotide
Download Length: 630 bp
>NTDB_id=567304 KIL87_RS18860 WP_000839153.1 3610100..3610729(-) (sxy/tfoX) [Escherichia coli strain 6883]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sxy/tfoX | Escherichia coli BW25113 strain K-12 |
100 |
100 |
1 |