Detailed information
Bioinformatically predicted
Overview
| Name | sxy/tfoX | Type | Regulator |
| Locus tag | KIL97_RS18990 | Genome accession | NZ_CP074958 |
| Coordinates | 3643136..3643765 (-) | Length | 209 a.a. |
| NCBI ID | WP_000839153.1 | Uniprot ID | A0A9Q6Y251 |
| Organism | Escherichia coli strain 03_3013 | ||
| Function | positive regulator of competence gene (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3617941..3656268 | 3643136..3643765 | within | 0 |
Gene organization within MGE regions
Location: 3617941..3656268
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIL97_RS18785 (KIL97_18570) | - | 3618162..3618434 (-) | 273 | WP_001342259.1 | hypothetical protein | - |
| KIL97_RS18790 (KIL97_18575) | - | 3618570..3618827 (+) | 258 | WP_001260977.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| KIL97_RS18795 (KIL97_18580) | - | 3618833..3619132 (+) | 300 | WP_000220601.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KIL97_RS18800 (KIL97_18585) | - | 3619337..3619681 (-) | 345 | WP_000206830.1 | hypothetical protein | - |
| KIL97_RS18805 (KIL97_18590) | - | 3619678..3620043 (-) | 366 | WP_001229296.1 | HNH endonuclease | - |
| KIL97_RS18810 (KIL97_18595) | - | 3620045..3620263 (-) | 219 | WP_000209152.1 | DUF4014 family protein | - |
| KIL97_RS18815 (KIL97_18600) | - | 3620474..3620986 (-) | 513 | Protein_3695 | ead/Ea22-like family protein | - |
| KIL97_RS18820 (KIL97_18605) | - | 3620983..3621159 (-) | 177 | WP_000753069.1 | hypothetical protein | - |
| KIL97_RS18825 (KIL97_18610) | - | 3621152..3621334 (-) | 183 | WP_001224662.1 | DUF7167 family protein | - |
| KIL97_RS18830 (KIL97_18615) | - | 3621368..3621580 (-) | 213 | WP_044723551.1 | hypothetical protein | - |
| KIL97_RS18835 (KIL97_18620) | - | 3621631..3621987 (-) | 357 | WP_000403783.1 | hypothetical protein | - |
| KIL97_RS18840 (KIL97_18625) | - | 3621965..3622426 (-) | 462 | WP_001209480.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
| KIL97_RS18845 (KIL97_18630) | - | 3622423..3622719 (-) | 297 | WP_001266133.1 | DUF4406 domain-containing protein | - |
| KIL97_RS18850 (KIL97_18635) | - | 3622716..3623108 (-) | 393 | WP_001040234.1 | DUF977 family protein | - |
| KIL97_RS18855 (KIL97_18640) | - | 3623124..3623849 (-) | 726 | WP_000450641.1 | DUF1627 domain-containing protein | - |
| KIL97_RS18860 (KIL97_18645) | - | 3623883..3624344 (-) | 462 | WP_000139447.1 | replication protein P | - |
| KIL97_RS18865 (KIL97_18650) | - | 3624337..3625347 (-) | 1011 | WP_042972104.1 | DUF1376 domain-containing protein | - |
| KIL97_RS18870 (KIL97_18655) | - | 3625434..3625871 (-) | 438 | WP_000693932.1 | toxin YdaT family protein | - |
| KIL97_RS18875 (KIL97_18660) | - | 3625868..3626128 (-) | 261 | WP_001172789.1 | transcriptional regulator | - |
| KIL97_RS18880 (KIL97_18665) | - | 3626255..3626647 (+) | 393 | WP_000578360.1 | helix-turn-helix domain-containing protein | - |
| KIL97_RS18885 (KIL97_18670) | - | 3626694..3627053 (-) | 360 | WP_001022415.1 | helix-turn-helix domain-containing protein | - |
| KIL97_RS18890 (KIL97_18675) | - | 3627056..3627358 (-) | 303 | WP_000692026.1 | type II toxin-antitoxin system HigB family toxin | - |
| KIL97_RS18895 | - | 3627772..3627972 (-) | 201 | WP_024182289.1 | ECs_2282 family putative zinc-binding protein | - |
| KIL97_RS18900 (KIL97_18685) | ydfC | 3628065..3628283 (+) | 219 | WP_001171921.1 | protein YdfC | - |
| KIL97_RS18905 (KIL97_18690) | - | 3628287..3628451 (-) | 165 | WP_001331716.1 | hypothetical protein | - |
| KIL97_RS18910 (KIL97_18695) | dicB | 3628852..3629040 (+) | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
| KIL97_RS18915 (KIL97_18700) | - | 3629037..3629225 (+) | 189 | WP_000199475.1 | DUF1482 family protein | - |
| KIL97_RS18920 (KIL97_18705) | - | 3629320..3631770 (+) | 2451 | WP_000048499.1 | exonuclease | - |
| KIL97_RS18925 (KIL97_18710) | - | 3631838..3632080 (+) | 243 | WP_000273151.1 | DUF4224 domain-containing protein | - |
| KIL97_RS18930 (KIL97_18715) | - | 3632058..3633077 (+) | 1020 | WP_001299351.1 | tyrosine-type recombinase/integrase | - |
| KIL97_RS18935 (KIL97_18720) | yccA | 3633485..3634144 (+) | 660 | WP_000375138.1 | FtsH protease modulator YccA | - |
| KIL97_RS18940 (KIL97_18725) | tusE | 3634235..3634564 (+) | 330 | WP_000904442.1 | sulfurtransferase TusE | - |
| KIL97_RS18945 (KIL97_18730) | yccX | 3634561..3634839 (-) | 279 | WP_000048244.1 | acylphosphatase | - |
| KIL97_RS18950 (KIL97_18735) | rlmI | 3634934..3636124 (+) | 1191 | WP_000116301.1 | 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI | - |
| KIL97_RS18955 (KIL97_18740) | hspQ | 3636182..3636499 (+) | 318 | WP_001295356.1 | heat shock protein HspQ | - |
| KIL97_RS18960 (KIL97_18745) | yccU | 3636544..3636957 (-) | 414 | WP_000665217.1 | CoA-binding protein | - |
| KIL97_RS18965 (KIL97_18750) | csgI | 3637130..3637792 (+) | 663 | WP_000847791.1 | DUF2057 family protein | - |
| KIL97_RS18970 (KIL97_18755) | mgsA | 3637888..3638346 (+) | 459 | WP_000424181.1 | methylglyoxal synthase | - |
| KIL97_RS18975 (KIL97_18760) | helD | 3638378..3640432 (-) | 2055 | WP_001297106.1 | DNA helicase IV | - |
| KIL97_RS18980 (KIL97_18765) | yccF | 3640555..3641001 (+) | 447 | WP_001261235.1 | YccF domain-containing protein | - |
| KIL97_RS18985 (KIL97_18770) | yccS | 3641011..3643173 (+) | 2163 | WP_000875023.1 | YccS family putative transporter | - |
| KIL97_RS18990 (KIL97_18775) | sxy/tfoX | 3643136..3643765 (-) | 630 | WP_000839153.1 | CRP-S regulon transcriptional coactivator Sxy | Regulator |
| KIL97_RS18995 (KIL97_18780) | sulA | 3643984..3644493 (+) | 510 | WP_000288710.1 | SOS-induced cell division inhibitor SulA | - |
| KIL97_RS19000 (KIL97_18785) | ompA | 3644850..3645890 (+) | 1041 | WP_000750416.1 | porin OmpA | - |
| KIL97_RS19005 (KIL97_18790) | matP | 3645965..3646417 (-) | 453 | WP_000877161.1 | macrodomain Ter protein MatP | - |
| KIL97_RS19010 (KIL97_18795) | ycbZ | 3646603..3648363 (+) | 1761 | WP_000156528.1 | AAA family ATPase | - |
| KIL97_RS19015 (KIL97_18800) | fabA | 3648432..3648950 (+) | 519 | WP_000227927.1 | bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase | - |
| KIL97_RS19020 (KIL97_18805) | rmf | 3649020..3649187 (-) | 168 | WP_000828648.1 | ribosome modulation factor | - |
| KIL97_RS19025 (KIL97_18810) | pqiC | 3649443..3650006 (-) | 564 | WP_000759122.1 | membrane integrity-associated transporter subunit PqiC | - |
| KIL97_RS19030 (KIL97_18815) | pqiB | 3650003..3651643 (-) | 1641 | WP_000445533.1 | intermembrane transport protein PqiB | - |
| KIL97_RS19035 (KIL97_18820) | pqiA | 3651648..3652901 (-) | 1254 | WP_000333176.1 | membrane integrity-associated transporter subunit PqiA | - |
| KIL97_RS19040 (KIL97_18825) | uup | 3653031..3654938 (-) | 1908 | WP_000053122.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 209 a.a. Molecular weight: 24147.02 Da Isoelectric Point: 9.2180
>NTDB_id=567086 KIL97_RS18990 WP_000839153.1 3643136..3643765(-) (sxy/tfoX) [Escherichia coli strain 03_3013]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
Nucleotide
Download Length: 630 bp
>NTDB_id=567086 KIL97_RS18990 WP_000839153.1 3643136..3643765(-) (sxy/tfoX) [Escherichia coli strain 03_3013]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sxy/tfoX | Escherichia coli BW25113 strain K-12 |
100 |
100 |
1 |