Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   KIM00_RS19235 Genome accession   NZ_CP074946
Coordinates   3644788..3645417 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 05_3471     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3619593..3657920 3644788..3645417 within 0


Gene organization within MGE regions


Location: 3619593..3657920
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIM00_RS19030 (KIM00_18770) - 3619814..3620086 (-) 273 WP_001342259.1 hypothetical protein -
  KIM00_RS19035 - 3620055..3620186 (-) 132 WP_001342258.1 hypothetical protein -
  KIM00_RS19040 (KIM00_18775) - 3620222..3620479 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  KIM00_RS19045 (KIM00_18780) - 3620485..3620784 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  KIM00_RS19050 (KIM00_18785) - 3620989..3621333 (-) 345 WP_000206830.1 hypothetical protein -
  KIM00_RS19055 (KIM00_18790) - 3621330..3621695 (-) 366 WP_001229296.1 HNH endonuclease -
  KIM00_RS19060 (KIM00_18795) - 3621697..3621915 (-) 219 WP_000209152.1 DUF4014 family protein -
  KIM00_RS19065 (KIM00_18800) - 3622126..3622638 (-) 513 Protein_3739 ead/Ea22-like family protein -
  KIM00_RS19070 (KIM00_18805) - 3622635..3622811 (-) 177 WP_000753069.1 hypothetical protein -
  KIM00_RS19075 (KIM00_18810) - 3622804..3622986 (-) 183 WP_001224662.1 DUF7167 family protein -
  KIM00_RS19080 (KIM00_18815) - 3623020..3623232 (-) 213 WP_000935422.1 hypothetical protein -
  KIM00_RS19085 (KIM00_18820) - 3623283..3623639 (-) 357 WP_000403783.1 hypothetical protein -
  KIM00_RS19090 (KIM00_18825) - 3623617..3624078 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  KIM00_RS19095 (KIM00_18830) - 3624075..3624371 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  KIM00_RS19100 (KIM00_18835) - 3624368..3624760 (-) 393 WP_001040234.1 DUF977 family protein -
  KIM00_RS19105 (KIM00_18840) - 3624776..3625501 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  KIM00_RS19110 (KIM00_18845) - 3625535..3625996 (-) 462 WP_000139444.1 replication protein P -
  KIM00_RS19115 (KIM00_18850) - 3625989..3626999 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  KIM00_RS19120 (KIM00_18855) - 3627086..3627523 (-) 438 WP_000693932.1 toxin YdaT family protein -
  KIM00_RS19125 (KIM00_18860) - 3627520..3627780 (-) 261 WP_001172789.1 transcriptional regulator -
  KIM00_RS19130 (KIM00_18865) - 3627907..3628299 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  KIM00_RS19135 (KIM00_18870) - 3628346..3628705 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  KIM00_RS19140 (KIM00_18875) - 3628708..3629010 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  KIM00_RS19145 - 3629424..3629624 (-) 201 WP_024182289.1 ECs_2282 family putative zinc-binding protein -
  KIM00_RS19150 (KIM00_18885) ydfC 3629717..3629935 (+) 219 WP_001171921.1 protein YdfC -
  KIM00_RS19155 (KIM00_18890) dicB 3630504..3630692 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  KIM00_RS19160 (KIM00_18895) - 3630689..3630877 (+) 189 WP_000199475.1 DUF1482 family protein -
  KIM00_RS19165 (KIM00_18900) - 3630972..3633422 (+) 2451 WP_000048499.1 exonuclease -
  KIM00_RS19170 (KIM00_18905) - 3633490..3633732 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  KIM00_RS19175 (KIM00_18910) - 3633710..3634729 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  KIM00_RS19180 (KIM00_18915) yccA 3635137..3635796 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  KIM00_RS19185 (KIM00_18920) tusE 3635887..3636216 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  KIM00_RS19190 (KIM00_18925) yccX 3636213..3636491 (-) 279 WP_000048244.1 acylphosphatase -
  KIM00_RS19195 (KIM00_18930) rlmI 3636586..3637776 (+) 1191 WP_000116301.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  KIM00_RS19200 (KIM00_18935) hspQ 3637834..3638151 (+) 318 WP_001295356.1 heat shock protein HspQ -
  KIM00_RS19205 (KIM00_18940) yccU 3638196..3638609 (-) 414 WP_000665217.1 CoA-binding protein -
  KIM00_RS19210 (KIM00_18945) csgI 3638782..3639444 (+) 663 WP_000847791.1 DUF2057 family protein -
  KIM00_RS19215 (KIM00_18950) mgsA 3639540..3639998 (+) 459 WP_000424181.1 methylglyoxal synthase -
  KIM00_RS19220 (KIM00_18955) helD 3640030..3642084 (-) 2055 WP_001297106.1 DNA helicase IV -
  KIM00_RS19225 (KIM00_18960) yccF 3642207..3642653 (+) 447 WP_001261235.1 YccF domain-containing protein -
  KIM00_RS19230 (KIM00_18965) yccS 3642663..3644825 (+) 2163 WP_000875023.1 YccS family putative transporter -
  KIM00_RS19235 (KIM00_18970) sxy/tfoX 3644788..3645417 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  KIM00_RS19240 (KIM00_18975) sulA 3645636..3646145 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  KIM00_RS19245 (KIM00_18980) ompA 3646502..3647542 (+) 1041 WP_000750416.1 porin OmpA -
  KIM00_RS19250 (KIM00_18985) matP 3647617..3648069 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  KIM00_RS19255 (KIM00_18990) ycbZ 3648255..3650015 (+) 1761 WP_000156528.1 AAA family ATPase -
  KIM00_RS19260 (KIM00_18995) fabA 3650084..3650602 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  KIM00_RS19265 (KIM00_19000) rmf 3650672..3650839 (-) 168 WP_000828648.1 ribosome modulation factor -
  KIM00_RS19270 (KIM00_19005) pqiC 3651095..3651658 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  KIM00_RS19275 (KIM00_19010) pqiB 3651655..3653295 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  KIM00_RS19280 (KIM00_19015) pqiA 3653300..3654553 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  KIM00_RS19285 (KIM00_19020) uup 3654683..3656590 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=567020 KIM00_RS19235 WP_000839153.1 3644788..3645417(-) (sxy/tfoX) [Escherichia coli strain 05_3471]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=567020 KIM00_RS19235 WP_000839153.1 3644788..3645417(-) (sxy/tfoX) [Escherichia coli strain 05_3471]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1