Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   KIM02_RS19230 Genome accession   NZ_CP074939
Coordinates   3679360..3679989 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 06_3235     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3651464..3691162 3679360..3679989 within 0


Gene organization within MGE regions


Location: 3651464..3691162
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIM02_RS19030 (KIM02_18815) - 3652827..3653024 (-) 198 WP_000917737.1 hypothetical protein -
  KIM02_RS19035 (KIM02_18820) - 3653311..3654129 (-) 819 WP_000265267.1 CPBP family intramembrane glutamic endopeptidase -
  KIM02_RS19040 (KIM02_18825) - 3654281..3654652 (-) 372 WP_000090265.1 antiterminator Q family protein -
  KIM02_RS19045 (KIM02_18830) - 3654642..3655013 (-) 372 WP_001217436.1 RusA family crossover junction endodeoxyribonuclease -
  KIM02_RS19050 (KIM02_18835) - 3655026..3656075 (-) 1050 WP_001265133.1 DUF968 domain-containing protein -
  KIM02_RS19055 (KIM02_18840) - 3656077..3656355 (-) 279 WP_001341388.1 hypothetical protein -
  KIM02_RS19060 (KIM02_18845) hokD 3656523..3656678 (-) 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
  KIM02_RS19065 (KIM02_18850) - 3656925..3657029 (-) 105 WP_001278454.1 hypothetical protein -
  KIM02_RS19070 - 3657145..3657483 (-) 339 WP_225288608.1 DUF551 domain-containing protein -
  KIM02_RS19075 - 3657598..3657684 (-) 87 Protein_3747 hypothetical protein -
  KIM02_RS19080 - 3657865..3658014 (-) 150 Protein_3748 hypothetical protein -
  KIM02_RS19085 (KIM02_18860) - 3658025..3658288 (-) 264 WP_000224233.1 hypothetical protein -
  KIM02_RS19090 (KIM02_18865) - 3658290..3658508 (-) 219 WP_000209148.1 DUF4014 family protein -
  KIM02_RS19095 (KIM02_18870) - 3658541..3658753 (-) 213 WP_000935423.1 hypothetical protein -
  KIM02_RS19100 (KIM02_18875) - 3658859..3659281 (-) 423 WP_001151235.1 DUF977 family protein -
  KIM02_RS19105 (KIM02_18880) - 3659297..3660067 (-) 771 WP_032324560.1 DUF1627 domain-containing protein -
  KIM02_RS19110 (KIM02_18885) - 3660093..3660833 (-) 741 WP_021498074.1 ATP-binding protein -
  KIM02_RS19115 (KIM02_18890) - 3660840..3661946 (-) 1107 WP_025380294.1 hypothetical protein -
  KIM02_RS19120 (KIM02_18895) - 3662018..3662443 (-) 426 WP_000693883.1 toxin YdaT family protein -
  KIM02_RS19125 (KIM02_18900) - 3662427..3662708 (-) 282 WP_000391948.1 transcriptional regulator -
  KIM02_RS19130 (KIM02_18905) - 3662808..3663227 (+) 420 WP_000362152.1 hypothetical protein -
  KIM02_RS19135 (KIM02_18910) - 3663494..3663646 (+) 153 WP_001345283.1 DUF1391 family protein -
  KIM02_RS19140 (KIM02_18915) - 3663658..3664296 (+) 639 WP_000394548.1 hypothetical protein -
  KIM02_RS19145 (KIM02_18920) - 3664297..3664506 (-) 210 WP_001133037.1 hypothetical protein -
  KIM02_RS19150 (KIM02_18925) dicB 3665074..3665262 (+) 189 WP_000413705.1 cell division inhibition protein DicB -
  KIM02_RS19155 (KIM02_18930) - 3665259..3665450 (+) 192 WP_001098307.1 DUF1482 family protein -
  KIM02_RS19160 (KIM02_18935) - 3665544..3667994 (+) 2451 WP_009448824.1 exonuclease -
  KIM02_RS19165 (KIM02_18940) - 3668062..3668304 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  KIM02_RS19170 (KIM02_18945) - 3668282..3669301 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  KIM02_RS19175 (KIM02_18950) yccA 3669709..3670368 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  KIM02_RS19180 (KIM02_18955) tusE 3670459..3670788 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  KIM02_RS19185 (KIM02_18960) yccX 3670785..3671063 (-) 279 WP_000048244.1 acylphosphatase -
  KIM02_RS19190 (KIM02_18965) rlmI 3671158..3672348 (+) 1191 WP_000116301.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  KIM02_RS19195 (KIM02_18970) hspQ 3672406..3672723 (+) 318 WP_001295356.1 heat shock protein HspQ -
  KIM02_RS19200 (KIM02_18975) yccU 3672768..3673181 (-) 414 WP_000665217.1 CoA-binding protein -
  KIM02_RS19205 (KIM02_18980) csgI 3673354..3674016 (+) 663 WP_000847791.1 DUF2057 family protein -
  KIM02_RS19210 (KIM02_18985) mgsA 3674112..3674570 (+) 459 WP_000424181.1 methylglyoxal synthase -
  KIM02_RS19215 (KIM02_18990) helD 3674602..3676656 (-) 2055 WP_001297106.1 DNA helicase IV -
  KIM02_RS19220 (KIM02_18995) yccF 3676779..3677225 (+) 447 WP_001261235.1 YccF domain-containing protein -
  KIM02_RS19225 (KIM02_19000) yccS 3677235..3679397 (+) 2163 WP_000875023.1 YccS family putative transporter -
  KIM02_RS19230 (KIM02_19005) sxy/tfoX 3679360..3679989 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  KIM02_RS19235 (KIM02_19010) sulA 3680208..3680717 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  KIM02_RS19240 (KIM02_19015) ompA 3681074..3682114 (+) 1041 WP_001400178.1 porin OmpA -
  KIM02_RS19245 (KIM02_19020) matP 3682189..3682641 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  KIM02_RS19250 (KIM02_19025) ycbZ 3682827..3684587 (+) 1761 WP_000156528.1 AAA family ATPase -
  KIM02_RS19255 (KIM02_19030) fabA 3684656..3685174 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  KIM02_RS19260 (KIM02_19035) rmf 3685244..3685411 (-) 168 WP_000828648.1 ribosome modulation factor -
  KIM02_RS19265 (KIM02_19040) pqiC 3685667..3686230 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  KIM02_RS19270 (KIM02_19045) pqiB 3686227..3687867 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  KIM02_RS19275 (KIM02_19050) pqiA 3687872..3689125 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  KIM02_RS19280 (KIM02_19055) uup 3689255..3691162 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=566978 KIM02_RS19230 WP_000839153.1 3679360..3679989(-) (sxy/tfoX) [Escherichia coli strain 06_3235]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=566978 KIM02_RS19230 WP_000839153.1 3679360..3679989(-) (sxy/tfoX) [Escherichia coli strain 06_3235]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1