Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   KIM45_RS09675 Genome accession   NZ_CP074766
Coordinates   1981120..1981749 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 99_0849     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1968617..2006944 1981120..1981749 within 0


Gene organization within MGE regions


Location: 1968617..2006944
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIM45_RS09625 (KIM45_09485) uup 1969947..1971854 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  KIM45_RS09630 (KIM45_09490) pqiA 1971984..1973237 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  KIM45_RS09635 (KIM45_09495) pqiB 1973242..1974882 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  KIM45_RS09640 (KIM45_09500) pqiC 1974879..1975442 (+) 564 WP_133394983.1 membrane integrity-associated transporter subunit PqiC -
  KIM45_RS09645 (KIM45_09505) rmf 1975698..1975865 (+) 168 WP_000828648.1 ribosome modulation factor -
  KIM45_RS09650 (KIM45_09510) fabA 1975935..1976453 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  KIM45_RS09655 (KIM45_09515) ycbZ 1976522..1978282 (-) 1761 WP_000156528.1 AAA family ATPase -
  KIM45_RS09660 (KIM45_09520) matP 1978468..1978920 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  KIM45_RS09665 (KIM45_09525) ompA 1978995..1980035 (-) 1041 WP_000750416.1 porin OmpA -
  KIM45_RS09670 (KIM45_09530) sulA 1980392..1980901 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  KIM45_RS09675 (KIM45_09535) sxy/tfoX 1981120..1981749 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  KIM45_RS09680 (KIM45_09540) yccS 1981712..1983874 (-) 2163 WP_000875023.1 YccS family putative transporter -
  KIM45_RS09685 (KIM45_09545) yccF 1983884..1984330 (-) 447 WP_001261235.1 YccF domain-containing protein -
  KIM45_RS09690 (KIM45_09550) helD 1984453..1986507 (+) 2055 WP_001297106.1 DNA helicase IV -
  KIM45_RS09695 (KIM45_09555) mgsA 1986539..1986997 (-) 459 WP_000424181.1 methylglyoxal synthase -
  KIM45_RS09700 (KIM45_09560) csgI 1987093..1987755 (-) 663 WP_000847791.1 DUF2057 family protein -
  KIM45_RS09705 (KIM45_09565) yccU 1987928..1988341 (+) 414 WP_000665217.1 CoA-binding protein -
  KIM45_RS09710 (KIM45_09570) hspQ 1988386..1988703 (-) 318 WP_001295356.1 heat shock protein HspQ -
  KIM45_RS09715 (KIM45_09575) rlmI 1988761..1989951 (-) 1191 WP_000116304.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  KIM45_RS09720 (KIM45_09580) yccX 1990046..1990324 (+) 279 WP_000048244.1 acylphosphatase -
  KIM45_RS09725 (KIM45_09585) tusE 1990321..1990650 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  KIM45_RS09730 (KIM45_09590) yccA 1990741..1991400 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  KIM45_RS09735 (KIM45_09595) - 1991808..1992827 (-) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  KIM45_RS09740 (KIM45_09600) - 1992805..1993047 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  KIM45_RS09745 (KIM45_09605) - 1993115..1995565 (-) 2451 WP_133394984.1 exonuclease -
  KIM45_RS09750 (KIM45_09610) - 1995660..1995848 (-) 189 WP_000199475.1 DUF1482 family protein -
  KIM45_RS09755 (KIM45_09615) dicB 1995845..1996033 (-) 189 WP_000449175.1 cell division inhibition protein DicB -
  KIM45_RS09760 (KIM45_09620) ydfC 1996602..1996820 (-) 219 WP_001171921.1 protein YdfC -
  KIM45_RS09765 - 1996913..1997113 (+) 201 WP_024182289.1 ECs_2282 family putative zinc-binding protein -
  KIM45_RS09770 (KIM45_09630) - 1997527..1997829 (+) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  KIM45_RS09775 (KIM45_09635) - 1997832..1998191 (+) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  KIM45_RS09780 (KIM45_09640) - 1998238..1998630 (-) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  KIM45_RS09785 (KIM45_09645) - 1998757..1999017 (+) 261 WP_001172789.1 transcriptional regulator -
  KIM45_RS09790 (KIM45_09650) - 1999014..1999451 (+) 438 WP_000693932.1 toxin YdaT family protein -
  KIM45_RS09795 (KIM45_09655) - 1999538..2000548 (+) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  KIM45_RS09800 (KIM45_09660) - 2000541..2001002 (+) 462 WP_000139444.1 replication protein P -
  KIM45_RS09805 (KIM45_09665) - 2001036..2001761 (+) 726 WP_000450641.1 DUF1627 domain-containing protein -
  KIM45_RS09810 (KIM45_09670) - 2001777..2002169 (+) 393 WP_001040234.1 DUF977 family protein -
  KIM45_RS09815 (KIM45_09675) - 2002166..2002462 (+) 297 WP_001266133.1 DUF4406 domain-containing protein -
  KIM45_RS09820 (KIM45_09680) - 2002459..2002920 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  KIM45_RS09825 (KIM45_09685) - 2002898..2003254 (+) 357 WP_000403783.1 hypothetical protein -
  KIM45_RS09830 (KIM45_09690) - 2003305..2003517 (+) 213 WP_000935422.1 hypothetical protein -
  KIM45_RS09835 (KIM45_09695) - 2003551..2003733 (+) 183 WP_001224662.1 DUF7167 family protein -
  KIM45_RS09840 (KIM45_09700) - 2003726..2003902 (+) 177 WP_000753069.1 hypothetical protein -
  KIM45_RS09845 (KIM45_09705) - 2003899..2004411 (+) 513 Protein_1907 ead/Ea22-like family protein -
  KIM45_RS09850 (KIM45_09710) - 2004622..2004840 (+) 219 WP_000209152.1 DUF4014 family protein -
  KIM45_RS09855 (KIM45_09715) - 2004842..2005207 (+) 366 WP_001229296.1 HNH endonuclease -
  KIM45_RS09860 (KIM45_09720) - 2005204..2005548 (+) 345 WP_000206830.1 hypothetical protein -
  KIM45_RS09865 (KIM45_09725) - 2005753..2006052 (-) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  KIM45_RS09870 (KIM45_09730) - 2006058..2006315 (-) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  KIM45_RS09875 (KIM45_09735) - 2006451..2006723 (+) 273 WP_001342259.1 hypothetical protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=566033 KIM45_RS09675 WP_000839153.1 1981120..1981749(+) (sxy/tfoX) [Escherichia coli strain 99_0849]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=566033 KIM45_RS09675 WP_000839153.1 1981120..1981749(+) (sxy/tfoX) [Escherichia coli strain 99_0849]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1