Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   BSU6051_RS16440 Genome accession   NC_020507
Coordinates   3255833..3256000 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis 6051-HGW     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250833..3261000
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU6051_RS16410 (BSU6051_31640) mrpE 3251230..3251706 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  BSU6051_RS16415 (BSU6051_31650) mrpF 3251706..3251990 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  BSU6051_RS16420 (BSU6051_31660) mnhG 3251974..3252348 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  BSU6051_RS16425 (BSU6051_31670) yuxO 3252387..3252767 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BSU6051_RS16430 (BSU6051_31680) comA 3252786..3253430 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSU6051_RS16435 (BSU6051_31690) comP 3253511..3255818 (-) 2308 Protein_3327 two-component system sensor histidine kinase ComP -
  BSU6051_RS16440 (BSU6051_31700) comX 3255833..3256000 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BSU6051_RS16445 (BSU6051_31710) comQ 3255988..3256887 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BSU6051_RS16450 (BSU6051_31720) degQ 3257072..3257212 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSU6051_RS22630 - 3257434..3257559 (+) 126 WP_003228793.1 hypothetical protein -
  BSU6051_RS16455 (BSU6051_31730) - 3257673..3258041 (+) 369 WP_003243784.1 hypothetical protein -
  BSU6051_RS16460 (BSU6051_31740) pdeH 3258017..3259246 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSU6051_RS16465 (BSU6051_31750) pncB 3259383..3260855 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=56595 BSU6051_RS16440 WP_003242801.1 3255833..3256000(-) (comX) [Bacillus subtilis subsp. subtilis 6051-HGW]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=56595 BSU6051_RS16440 WP_003242801.1 3255833..3256000(-) (comX) [Bacillus subtilis subsp. subtilis 6051-HGW]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment