Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   BSU6051_RS13360 Genome accession   NC_020507
Coordinates   2652370..2652780 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis subsp. subtilis 6051-HGW     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647736..2699226 2652370..2652780 within 0


Gene organization within MGE regions


Location: 2647736..2699226
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU6051_RS13335 (BSU6051_25700) yqeF 2647903..2648634 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  BSU6051_RS13340 (BSU6051_25710) cwlH 2648886..2649638 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  BSU6051_RS13345 (BSU6051_25720) yqeD 2649825..2650451 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  BSU6051_RS13350 (BSU6051_25730) gnd 2650470..2651363 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  BSU6051_RS13355 (BSU6051_25740) yqeB 2651615..2652337 (+) 723 WP_010886572.1 hypothetical protein -
  BSU6051_RS13360 (BSU6051_25750) nucA/comI 2652370..2652780 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  BSU6051_RS13365 (BSU6051_25760) - 2652976..2653323 (+) 348 Protein_2701 sigma-70 family RNA polymerase sigma factor -
  BSU6051_RS13370 (BSU6051_25770) spoIVCA 2653354..2654814 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  BSU6051_RS22845 - 2654772..2654950 (-) 179 Protein_2703 hypothetical protein -
  BSU6051_RS13375 (BSU6051_25780) arsC 2655305..2655724 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  BSU6051_RS13380 (BSU6051_25790) acr3 2655736..2656776 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  BSU6051_RS13385 (BSU6051_25800) arsK 2656799..2657239 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  BSU6051_RS13390 (BSU6051_25810) arsR 2657300..2657617 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  BSU6051_RS13395 (BSU6051_25820) yqcI 2657989..2658753 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  BSU6051_RS13400 (BSU6051_25830) rapE 2659196..2660323 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  BSU6051_RS13405 (BSU6051_25840) phrE 2660313..2660447 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  BSU6051_RS21925 (BSU6051_25850) - 2660557..2660715 (+) 159 WP_003245945.1 hypothetical protein -
  BSU6051_RS13410 (BSU6051_25860) yqcG 2661085..2662680 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  BSU6051_RS13415 (BSU6051_25870) yqcF 2662695..2663273 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  BSU6051_RS22530 - 2663391..2663537 (+) 147 WP_009967791.1 hypothetical protein -
  BSU6051_RS13420 (BSU6051_25880) - 2663534..2663896 (-) 363 WP_003229947.1 hypothetical protein -
  BSU6051_RS13425 (BSU6051_25890) - 2663912..2664391 (-) 480 WP_004399085.1 hypothetical protein -
  BSU6051_RS13430 (BSU6051_25900) cwlA 2664556..2665374 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  BSU6051_RS13435 (BSU6051_25910) skhD 2665419..2665841 (-) 423 WP_003246208.1 holin family protein -
  BSU6051_RS13440 (BSU6051_25920) xepAK 2665886..2666779 (-) 894 WP_003246010.1 hypothetical protein -
  BSU6051_RS13445 (BSU6051_25930) yqcE 2666867..2667031 (-) 165 WP_003229944.1 XkdX family protein -
  BSU6051_RS13450 (BSU6051_25940) yqcD 2667028..2667363 (-) 336 WP_009967793.1 XkdW family protein -
  BSU6051_RS13455 (BSU6051_25950) yqcC 2667373..2668473 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  BSU6051_RS13460 (BSU6051_25960) - 2668476..2668748 (-) 273 WP_003229942.1 hypothetical protein -
  BSU6051_RS13465 (BSU6051_25970) yqcA 2668745..2669323 (-) 579 WP_003229941.1 YmfQ family protein -
  BSU6051_RS13470 (BSU6051_25980) yqbT 2669307..2670353 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  BSU6051_RS13475 (BSU6051_25990) yqbS 2670346..2670771 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  BSU6051_RS13480 (BSU6051_26000) yqbR 2670784..2671047 (-) 264 WP_003229938.1 DUF2577 family protein -
  BSU6051_RS13485 (BSU6051_26010) yqbQ 2671044..2672024 (-) 981 WP_004398524.1 hypothetical protein -
  BSU6051_RS13490 (BSU6051_26020) yqbP 2672037..2672696 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  BSU6051_RS13495 (BSU6051_26030) yqbO 2672689..2677446 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  BSU6051_RS21930 - 2677449..2677586 (-) 138 WP_003229934.1 hypothetical protein -
  BSU6051_RS13500 (BSU6051_26039) - 2677628..2678077 (-) 450 WP_003229933.1 phage portal protein -
  BSU6051_RS13505 (BSU6051_26050) txpA 2678223..2678402 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  BSU6051_RS22535 bsrH 2678782..2678871 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  BSU6051_RS13510 (BSU6051_26060) yqbM 2679125..2679568 (-) 444 WP_003229930.1 phage tail tube protein -
  BSU6051_RS13515 (BSU6051_26075) yqbK 2679571..2680971 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  BSU6051_RS13520 (BSU6051_26089) - 2680972..2681163 (-) 192 WP_010886574.1 hypothetical protein -
  BSU6051_RS13525 (BSU6051_26090) yqbJ 2681160..2681597 (-) 438 WP_003229927.1 DUF6838 family protein -
  BSU6051_RS13530 (BSU6051_26100) yqbI 2681610..2682113 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  BSU6051_RS13535 (BSU6051_26110) yqbH 2682110..2682472 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  BSU6051_RS13540 (BSU6051_26120) gkpG 2682469..2682864 (-) 396 WP_004398566.1 DUF3199 family protein -
  BSU6051_RS13545 (BSU6051_26130) yqbF 2682868..2683179 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  BSU6051_RS13550 (BSU6051_26140) skdG 2683190..2684125 (-) 936 WP_003229922.1 phage major capsid protein -
  BSU6051_RS13555 (BSU6051_26150) yqbD 2684144..2685112 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  BSU6051_RS13560 (BSU6051_26160) - 2685145..2685798 (-) 654 WP_003229920.1 hypothetical protein -
  BSU6051_RS13565 (BSU6051_26170) yqbB 2685839..2686756 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  BSU6051_RS13570 (BSU6051_26180) yqbA 2686753..2688285 (-) 1533 WP_004398894.1 phage portal protein -
  BSU6051_RS13575 (BSU6051_26190) stmB 2688289..2689584 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  BSU6051_RS13580 (BSU6051_26200) terS 2689577..2690296 (-) 720 WP_003229916.1 phage terminase small subunit -
  BSU6051_RS13585 (BSU6051_26210) - 2690364..2690828 (-) 465 WP_004398685.1 hypothetical protein -
  BSU6051_RS13590 (BSU6051_26220) yqaQ 2690972..2691427 (-) 456 WP_004398775.1 hypothetical protein -
  BSU6051_RS13595 (BSU6051_26230) - 2691625..2692554 (+) 930 WP_003229913.1 hypothetical protein -
  BSU6051_RS13600 (BSU6051_26240) yqaO 2692628..2692834 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  BSU6051_RS13605 (BSU6051_26250) yqaN 2692916..2693344 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  BSU6051_RS21940 (BSU6051_26259) - 2693440..2693589 (-) 150 WP_003229910.1 hypothetical protein -
  BSU6051_RS13610 (BSU6051_26260) sknM 2693580..2694521 (-) 942 WP_075058863.1 ATP-binding protein -
  BSU6051_RS13615 (BSU6051_26270) yqaL 2694403..2695080 (-) 678 WP_010886575.1 DnaD domain protein -
  BSU6051_RS13620 (BSU6051_26280) recT 2695156..2696010 (-) 855 WP_003229907.1 recombinase RecT -
  BSU6051_RS13625 (BSU6051_26290) yqaJ 2696013..2696972 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  BSU6051_RS13630 (BSU6051_26300) - 2697078..2697272 (-) 195 WP_003229905.1 hypothetical protein -
  BSU6051_RS22540 - 2697232..2697405 (-) 174 WP_119123069.1 hypothetical protein -
  BSU6051_RS13635 (BSU6051_26310) sknH 2697402..2697659 (-) 258 WP_003245994.1 YqaH family protein -
  BSU6051_RS13640 (BSU6051_26320) yqaG 2697656..2698225 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  BSU6051_RS21945 (BSU6051_26330) - 2698299..2698439 (-) 141 WP_003229902.1 hypothetical protein -
  BSU6051_RS13645 (BSU6051_26340) yqaF 2698469..2698699 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  BSU6051_RS13650 (BSU6051_26350) sknR 2698876..2699226 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=56585 BSU6051_RS13360 WP_009967785.1 2652370..2652780(-) (nucA/comI) [Bacillus subtilis subsp. subtilis 6051-HGW]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=56585 BSU6051_RS13360 WP_009967785.1 2652370..2652780(-) (nucA/comI) [Bacillus subtilis subsp. subtilis 6051-HGW]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment