Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   KH263_RS11950 Genome accession   NZ_CP074685
Coordinates   2515528..2515794 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain VTX9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2510528..2520794
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH263_RS11900 (KH263_11900) sinR 2510693..2511028 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH263_RS11905 (KH263_11905) - 2511076..2511861 (-) 786 WP_015388008.1 TasA family protein -
  KH263_RS11910 (KH263_11910) - 2511925..2512509 (-) 585 WP_012117977.1 signal peptidase I -
  KH263_RS11915 (KH263_11915) tapA 2512481..2513152 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  KH263_RS11920 (KH263_11920) - 2513411..2513740 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KH263_RS11925 (KH263_11925) - 2513780..2513959 (-) 180 WP_003153093.1 YqzE family protein -
  KH263_RS11930 (KH263_11930) comGG 2514016..2514393 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH263_RS11935 (KH263_11935) comGF 2514394..2514789 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  KH263_RS11940 (KH263_11940) comGE 2514803..2515117 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KH263_RS11945 (KH263_11945) comGD 2515101..2515538 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  KH263_RS11950 (KH263_11950) comGC 2515528..2515794 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  KH263_RS11955 (KH263_11955) comGB 2515841..2516878 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  KH263_RS11960 (KH263_11960) comGA 2516865..2517936 (-) 1072 Protein_2330 competence type IV pilus ATPase ComGA -
  KH263_RS11965 (KH263_11965) - 2518128..2519078 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  KH263_RS11970 (KH263_11970) - 2519224..2520525 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=565734 KH263_RS11950 WP_042635730.1 2515528..2515794(-) (comGC) [Bacillus velezensis strain VTX9]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=565734 KH263_RS11950 WP_042635730.1 2515528..2515794(-) (comGC) [Bacillus velezensis strain VTX9]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602