Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MID01_RS17320 Genome accession   NZ_CP092369
Coordinates   3284835..3284975 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ZW     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3279835..3289975
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MID01_RS17290 (MID01_17290) mnhG 3279857..3280231 (+) 375 WP_015714623.1 monovalent cation/H(+) antiporter subunit G -
  MID01_RS17295 (MID01_17295) yuxO 3280270..3280650 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  MID01_RS17300 (MID01_17300) - 3280669..3281221 (-) 553 Protein_3354 response regulator transcription factor -
  MID01_RS17305 (MID01_17305) comP 3281302..3283602 (-) 2301 WP_088300729.1 histidine kinase Regulator
  MID01_RS17310 (MID01_17310) comX 3283614..3283778 (-) 165 WP_015384519.1 competence pheromone ComX -
  MID01_RS17315 (MID01_17315) comQ 3283791..3284651 (-) 861 WP_041850585.1 polyprenyl synthetase family protein Regulator
  MID01_RS17320 (MID01_17320) degQ 3284835..3284975 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MID01_RS17325 (MID01_17325) - 3285197..3285259 (+) 63 Protein_3359 hypothetical protein -
  MID01_RS17330 (MID01_17330) - 3285438..3285806 (+) 369 WP_041850584.1 hypothetical protein -
  MID01_RS17335 (MID01_17335) pdeH 3285782..3287011 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MID01_RS17340 (MID01_17340) pncB 3287148..3288620 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MID01_RS17345 (MID01_17345) pncA 3288636..3289187 (-) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  MID01_RS17350 (MID01_17350) yueI 3289284..3289682 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=565063 MID01_RS17320 WP_003220708.1 3284835..3284975(-) (degQ) [Bacillus subtilis strain ZW]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=565063 MID01_RS17320 WP_003220708.1 3284835..3284975(-) (degQ) [Bacillus subtilis strain ZW]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1