Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MID01_RS12950 Genome accession   NZ_CP092369
Coordinates   2504258..2504431 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain ZW     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2499258..2509431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MID01_RS12935 (MID01_12935) gcvT 2500058..2501146 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  MID01_RS12940 (MID01_12940) yqhH 2501587..2503260 (+) 1674 WP_041850014.1 SNF2-related protein -
  MID01_RS12945 (MID01_12945) yqhG 2503281..2504075 (+) 795 WP_003230200.1 YqhG family protein -
  MID01_RS12950 (MID01_12950) sinI 2504258..2504431 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MID01_RS12955 (MID01_12955) sinR 2504465..2504800 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MID01_RS12960 (MID01_12960) tasA 2504893..2505678 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MID01_RS12965 (MID01_12965) sipW 2505742..2506314 (-) 573 WP_003246088.1 signal peptidase I -
  MID01_RS12970 (MID01_12970) tapA 2506298..2507059 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MID01_RS12975 (MID01_12975) yqzG 2507331..2507657 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MID01_RS12980 (MID01_12980) spoIIT 2507699..2507878 (-) 180 WP_003230176.1 YqzE family protein -
  MID01_RS12985 (MID01_12985) comGG 2507949..2508323 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MID01_RS12990 (MID01_12990) comGF 2508324..2508707 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  MID01_RS12995 (MID01_12995) comGE 2508733..2509080 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=565028 MID01_RS12950 WP_003230187.1 2504258..2504431(+) (sinI) [Bacillus subtilis strain ZW]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=565028 MID01_RS12950 WP_003230187.1 2504258..2504431(+) (sinI) [Bacillus subtilis strain ZW]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1