Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KHA74_RS15715 Genome accession   NZ_CP074348
Coordinates   3196559..3196699 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SW5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3191559..3201699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA74_RS15690 (KHA74_15610) - 3191886..3192269 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  KHA74_RS15695 (KHA74_15615) comA 3192291..3192935 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KHA74_RS15700 (KHA74_15620) comP 3193016..3195322 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  KHA74_RS15705 (KHA74_15625) comX 3195341..3195517 (-) 177 WP_015240484.1 competence pheromone ComX -
  KHA74_RS15710 (KHA74_15630) - 3195532..3196407 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  KHA74_RS15715 (KHA74_15635) degQ 3196559..3196699 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KHA74_RS15720 (KHA74_15640) - 3197162..3197503 (+) 342 WP_007408677.1 hypothetical protein -
  KHA74_RS15725 (KHA74_15645) - 3197510..3198733 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  KHA74_RS15730 (KHA74_15650) - 3198863..3200329 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  KHA74_RS15735 (KHA74_15655) - 3200347..3200898 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KHA74_RS15740 (KHA74_15660) - 3200995..3201393 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=564094 KHA74_RS15715 WP_003152043.1 3196559..3196699(-) (degQ) [Bacillus velezensis strain SW5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=564094 KHA74_RS15715 WP_003152043.1 3196559..3196699(-) (degQ) [Bacillus velezensis strain SW5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891