Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAM5036_RS14325 Genome accession   NC_020410
Coordinates   2978639..2978779 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis UCMB5036     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2973639..2983779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAM5036_RS14300 (BAM5036_2790) - 2973953..2974336 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BAM5036_RS14305 (BAM5036_2791) comA 2974358..2975002 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAM5036_RS14310 (BAM5036_2792) comP 2975083..2977434 (-) 2352 WP_015418104.1 sensor histidine kinase Regulator
  BAM5036_RS14315 (BAM5036_2793) comX 2977412..2977582 (-) 171 WP_015418105.1 competence pheromone ComX -
  BAM5036_RS14320 (BAM5036_2794) - 2977579..2978508 (-) 930 WP_015418106.1 polyprenyl synthetase family protein -
  BAM5036_RS14325 (BAM5036_2795) degQ 2978639..2978779 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAM5036_RS14330 (BAM5036_2796) - 2979242..2979583 (+) 342 WP_015418107.1 hypothetical protein -
  BAM5036_RS14335 (BAM5036_2797) - 2979590..2980813 (-) 1224 WP_015418108.1 EAL and HDOD domain-containing protein -
  BAM5036_RS14340 (BAM5036_2798) - 2980943..2982409 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  BAM5036_RS14345 (BAM5036_2799) - 2982427..2982978 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAM5036_RS14350 (BAM5036_2800) - 2983075..2983473 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=56398 BAM5036_RS14325 WP_003152043.1 2978639..2978779(-) (degQ) [Bacillus velezensis UCMB5036]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=56398 BAM5036_RS14325 WP_003152043.1 2978639..2978779(-) (degQ) [Bacillus velezensis UCMB5036]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment