Detailed information    

insolico Bioinformatically predicted

Overview


Name   ceuB   Type   Machinery gene
Locus tag   LT41_RS07375 Genome accession   NZ_CP073712
Coordinates   1394246..1395214 (+) Length   322 a.a.
NCBI ID   WP_002872671.1    Uniprot ID   Q0P8Q7
Organism   Campylobacter jejuni strain G1     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1395894..1428351 1394246..1395214 flank 680


Gene organization within MGE regions


Location: 1394246..1428351
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT41_RS07375 (LT41_007375) ceuB 1394246..1395214 (+) 969 WP_002872671.1 ABC transporter permease Machinery gene
  LT41_RS07380 (LT41_007380) - 1395207..1395716 (+) 510 Protein_1449 iron chelate uptake ABC transporter family permease subunit -
  LT41_RS07385 (LT41_007385) - 1395894..1396523 (+) 630 WP_032584178.1 S24 family peptidase -
  LT41_RS07390 (LT41_007390) - 1396604..1396924 (+) 321 WP_002865000.1 hypothetical protein -
  LT41_RS07395 (LT41_007395) - 1396934..1397128 (+) 195 WP_002843339.1 hypothetical protein -
  LT41_RS07400 (LT41_007400) - 1397208..1397495 (+) 288 WP_002865289.1 hypothetical protein -
  LT41_RS07405 (LT41_007405) - 1397523..1398338 (-) 816 WP_032584260.1 DNA adenine methylase -
  LT41_RS07410 (LT41_007410) - 1398440..1399408 (-) 969 WP_032584176.1 phage tail protein -
  LT41_RS07415 (LT41_007415) - 1399402..1399593 (-) 192 WP_032584174.1 tail protein X -
  LT41_RS07420 (LT41_007420) - 1399586..1399960 (-) 375 WP_002870151.1 phage tail protein -
  LT41_RS07425 (LT41_007425) - 1399962..1401926 (-) 1965 WP_032584171.1 phage tail tape measure protein -
  LT41_RS07430 (LT41_007430) - 1401956..1402186 (+) 231 WP_032584169.1 hypothetical protein -
  LT41_RS07435 (LT41_007435) - 1402294..1402530 (-) 237 WP_002789979.1 phage tail assembly protein -
  LT41_RS07440 (LT41_007440) - 1402541..1403056 (-) 516 WP_032584167.1 phage major tail tube protein -
  LT41_RS07445 (LT41_007445) - 1403203..1404393 (-) 1191 WP_212210980.1 phage tail sheath family protein -
  LT41_RS07450 (LT41_007450) - 1404404..1405417 (-) 1014 WP_032584253.1 hypothetical protein -
  LT41_RS07455 (LT41_007455) - 1405517..1405888 (-) 372 WP_002938257.1 DUF1353 domain-containing protein -
  LT41_RS07460 (LT41_007460) - 1405885..1406391 (-) 507 WP_032584251.1 DUF4376 domain-containing protein -
  LT41_RS07465 (LT41_007465) - 1406416..1407447 (-) 1032 WP_032584249.1 phage tail protein -
  LT41_RS07470 (LT41_007470) - 1407447..1408067 (-) 621 WP_002878911.1 phage tail protein I -
  LT41_RS07475 (LT41_007475) - 1408064..1409230 (-) 1167 WP_032584246.1 baseplate J/gp47 family protein -
  LT41_RS07480 (LT41_007480) - 1409227..1409517 (-) 291 WP_002795239.1 GPW/gp25 family protein -
  LT41_RS07485 (LT41_007485) - 1409514..1409705 (-) 192 WP_002795238.1 hypothetical protein -
  LT41_RS07490 (LT41_007490) - 1409714..1410346 (-) 633 WP_032584244.1 phage baseplate assembly protein V -
  LT41_RS07495 (LT41_007495) - 1410343..1410807 (-) 465 WP_002865847.1 DUF1804 family protein -
  LT41_RS07500 (LT41_007500) - 1410938..1411978 (+) 1041 WP_002790001.1 phage protease -
  LT41_RS07505 (LT41_007505) - 1411978..1412865 (+) 888 WP_002790002.1 Mu-like prophage major head subunit gpT family protein -
  LT41_RS07510 (LT41_007510) - 1412865..1413134 (+) 270 WP_019108985.1 hypothetical protein -
  LT41_RS07515 (LT41_007515) - 1413131..1413484 (+) 354 WP_002790896.1 hypothetical protein -
  LT41_RS07520 (LT41_007520) - 1413614..1413979 (+) 366 WP_002790266.1 hypothetical protein -
  LT41_RS07525 (LT41_007525) - 1413969..1414358 (+) 390 WP_002922136.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  LT41_RS07530 (LT41_007530) - 1414369..1414710 (+) 342 WP_002854893.1 hypothetical protein -
  LT41_RS07535 (LT41_007535) - 1414707..1414955 (+) 249 WP_002784496.1 hypothetical protein -
  LT41_RS07540 (LT41_007540) - 1415067..1415381 (+) 315 WP_002790261.1 phage holin family protein -
  LT41_RS07545 (LT41_007545) terL 1415471..1416997 (+) 1527 WP_002865465.1 phage terminase large subunit -
  LT41_RS07550 (LT41_007550) - 1416994..1418376 (+) 1383 WP_002870186.1 DUF935 family protein -
  LT41_RS07555 (LT41_007555) - 1418369..1419502 (+) 1134 WP_002870187.1 phage minor head protein -
  LT41_RS07560 (LT41_007560) - 1419641..1420120 (-) 480 WP_021358121.1 phage virion morphogenesis protein -
  LT41_RS07565 (LT41_007565) - 1420107..1420298 (-) 192 WP_021358120.1 hypothetical protein -
  LT41_RS07570 (LT41_007570) - 1420350..1420778 (-) 429 WP_002790255.1 hypothetical protein -
  LT41_RS07575 (LT41_007575) - 1420775..1420954 (-) 180 WP_002864977.1 hypothetical protein -
  LT41_RS07580 (LT41_007580) - 1421069..1421455 (-) 387 WP_032584068.1 YopX family protein -
  LT41_RS07585 (LT41_007585) - 1421452..1421724 (-) 273 WP_002791414.1 hypothetical protein -
  LT41_RS07590 (LT41_007590) - 1421788..1421967 (-) 180 WP_002791416.1 hypothetical protein -
  LT41_RS07595 (LT41_007595) - 1421964..1422449 (-) 486 WP_002806832.1 host-nuclease inhibitor Gam family protein -
  LT41_RS07600 (LT41_007600) - 1422644..1422982 (-) 339 WP_032584063.1 DUF4406 domain-containing protein -
  LT41_RS07605 (LT41_007605) - 1423056..1423487 (-) 432 WP_002865075.1 SA1788 family PVL leukocidin-associated protein -
  LT41_RS07610 (LT41_007610) - 1423542..1423727 (-) 186 WP_002824157.1 hypothetical protein -
  LT41_RS07615 (LT41_007615) - 1423724..1423915 (-) 192 WP_002795448.1 sigma factor-like helix-turn-helix DNA-binding protein -
  LT41_RS07620 (LT41_007620) - 1423912..1424769 (-) 858 WP_002790751.1 AAA family ATPase -
  LT41_RS07625 (LT41_007625) - 1424858..1426972 (-) 2115 WP_032584061.1 Mu transposase C-terminal domain-containing protein -
  LT41_RS07630 (LT41_007630) - 1426973..1427164 (-) 192 WP_002876364.1 hypothetical protein -
  LT41_RS07635 (LT41_007635) - 1427180..1427449 (-) 270 WP_032584059.1 hypothetical protein -
  LT41_RS07640 (LT41_007640) - 1427548..1428351 (+) 804 WP_002938466.1 S24 family peptidase -

Sequence


Protein


Download         Length: 322 a.a.        Molecular weight: 35469.40 Da        Isoelectric Point: 9.6678

>NTDB_id=560097 LT41_RS07375 WP_002872671.1 1394246..1395214(+) (ceuB) [Campylobacter jejuni strain G1]
MFFKHILSLKVLIALLLFFGMISLFIGVISINVKDILNLNSTQLEIITLTRIPRLIAILLTGMSLSICGLIMQQLTQNKF
VSPTTAGTMDCAKFGILISLIFFTGASFFTQAIIASIFALLGSFIFIQILRKIKLKDVIFVPLIGLMFGGIISAITTFFA
YALNYIQNIQGWLQGSMANVMQGNYELLYISLPLFILAYFLAHKITIVGMGEDIALNLGISYNGILFLGLMIVSIITSLV
IVSVGIIPFLGLIIPNLVALYLGDNLRKNLIYIALCGALFLLVCDIISRLVIFPFEMPLSITTGVLGSLIFIFLLLKRKV
YA

Nucleotide


Download         Length: 969 bp        

>NTDB_id=560097 LT41_RS07375 WP_002872671.1 1394246..1395214(+) (ceuB) [Campylobacter jejuni strain G1]
TTGTTTTTTAAGCATATATTGAGTTTAAAAGTGCTTATAGCTTTACTTTTATTCTTTGGAATGATAAGTTTATTTATAGG
AGTTATCAGTATCAATGTAAAAGATATTCTTAATCTTAACTCCACTCAACTAGAAATCATAACTCTCACAAGAATTCCTA
GACTTATAGCGATTTTACTCACAGGAATGAGTCTTAGTATATGTGGGCTTATCATGCAACAACTCACGCAAAATAAATTC
GTTTCCCCAACTACAGCAGGGACCATGGATTGTGCTAAATTTGGCATACTTATTTCTTTAATATTTTTTACTGGAGCGTC
TTTTTTCACTCAAGCTATCATTGCTTCTATATTTGCACTTTTGGGTTCTTTTATATTTATCCAAATTTTAAGAAAAATCA
AACTCAAAGATGTGATTTTTGTACCTTTGATAGGCTTGATGTTTGGAGGTATTATTAGTGCTATAACCACTTTTTTTGCC
TATGCTTTAAATTATATACAAAATATCCAAGGTTGGCTACAAGGCAGTATGGCAAATGTTATGCAGGGAAATTATGAATT
GCTCTACATTTCTTTACCACTTTTTATACTTGCTTATTTTTTAGCTCATAAAATCACCATAGTTGGCATGGGTGAAGATA
TAGCTTTAAATCTTGGAATTTCTTATAATGGTATATTATTTTTAGGCTTAATGATTGTAAGCATTATCACTAGCTTAGTG
ATTGTAAGCGTTGGGATTATCCCTTTTTTAGGGCTAATTATCCCAAATTTAGTAGCTCTTTATCTAGGTGATAATCTTAG
AAAAAATCTTATCTATATAGCACTTTGTGGAGCTTTGTTTTTACTTGTTTGCGATATCATTTCAAGACTTGTTATCTTTC
CTTTTGAAATGCCTTTAAGTATCACTACAGGTGTTTTAGGGTCTTTAATCTTTATCTTTCTTTTACTAAAAAGGAAAGTT
TATGCGTAA

Domains


Predicted by InterproScan.

(15-317)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q0P8Q7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ceuB Campylobacter jejuni subsp. jejuni 81-176

99.068

100

0.991