Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KEC47_RS01975 Genome accession   NZ_CP073656
Coordinates   423079..423198 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Y816     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 418079..428198
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEC47_RS01960 (KEC47_01960) - 419691..420374 (+) 684 WP_094247243.1 response regulator transcription factor -
  KEC47_RS01965 (KEC47_01965) - 420361..421794 (+) 1434 WP_161941456.1 HAMP domain-containing sensor histidine kinase -
  KEC47_RS01970 (KEC47_01970) rapC 421947..423095 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  KEC47_RS01975 (KEC47_01975) phrC 423079..423198 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KEC47_RS01980 (KEC47_01980) - 423348..423443 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  KEC47_RS01985 (KEC47_01985) - 423538..424902 (-) 1365 WP_176283117.1 aspartate kinase -
  KEC47_RS01990 (KEC47_01990) ceuB 425317..426270 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  KEC47_RS01995 (KEC47_01995) - 426260..427207 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  KEC47_RS02000 (KEC47_02000) - 427201..427959 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=559704 KEC47_RS01975 WP_003156334.1 423079..423198(+) (phrC) [Bacillus velezensis strain Y816]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=559704 KEC47_RS01975 WP_003156334.1 423079..423198(+) (phrC) [Bacillus velezensis strain Y816]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718