Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | KEF49_RS15095 | Genome accession | NZ_CP073635 |
| Coordinates | 2965710..2965850 (-) | Length | 46 a.a. |
| NCBI ID | WP_013353398.1 | Uniprot ID | P06532 |
| Organism | Bacillus amyloliquefaciens strain Ba13 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2960710..2970850
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KEF49_RS15070 (KEF49_15070) | - | 2961024..2961407 (-) | 384 | WP_212099079.1 | hotdog fold thioesterase | - |
| KEF49_RS15075 (KEF49_15075) | comA | 2961429..2962073 (-) | 645 | WP_014472195.1 | response regulator transcription factor | Regulator |
| KEF49_RS15080 (KEF49_15080) | - | 2962154..2964508 (-) | 2355 | Protein_2934 | histidine kinase | - |
| KEF49_RS15085 (KEF49_15085) | comX | 2964486..2964656 (-) | 171 | WP_212099082.1 | competence pheromone ComX | - |
| KEF49_RS15090 (KEF49_15090) | comQ | 2964671..2965579 (-) | 909 | WP_249199260.1 | polyprenyl synthetase family protein | Regulator |
| KEF49_RS15095 (KEF49_15095) | degQ | 2965710..2965850 (-) | 141 | WP_013353398.1 | degradation enzyme regulation protein DegQ | Regulator |
| KEF49_RS15100 (KEF49_15100) | - | 2966315..2966656 (+) | 342 | WP_115997039.1 | hypothetical protein | - |
| KEF49_RS15105 (KEF49_15105) | - | 2966662..2967885 (-) | 1224 | WP_115997038.1 | EAL and HDOD domain-containing protein | - |
| KEF49_RS15110 (KEF49_15110) | - | 2968015..2969481 (-) | 1467 | WP_115997037.1 | nicotinate phosphoribosyltransferase | - |
| KEF49_RS15115 (KEF49_15115) | - | 2969499..2970050 (-) | 552 | WP_212099085.1 | isochorismatase family cysteine hydrolase | - |
| KEF49_RS15120 (KEF49_15120) | - | 2970131..2970526 (-) | 396 | WP_013353403.1 | DUF1694 domain-containing protein | - |
| KEF49_RS15125 (KEF49_15125) | - | 2970592..2970840 (-) | 249 | WP_013353404.1 | YueH family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5532.37 Da Isoelectric Point: 6.2567
>NTDB_id=559614 KEF49_RS15095 WP_013353398.1 2965710..2965850(-) (degQ) [Bacillus amyloliquefaciens strain Ba13]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=559614 KEF49_RS15095 WP_013353398.1 2965710..2965850(-) (degQ) [Bacillus amyloliquefaciens strain Ba13]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
91.304 |
100 |
0.913 |