Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KEF49_RS15095 Genome accession   NZ_CP073635
Coordinates   2965710..2965850 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain Ba13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2960710..2970850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEF49_RS15070 (KEF49_15070) - 2961024..2961407 (-) 384 WP_212099079.1 hotdog fold thioesterase -
  KEF49_RS15075 (KEF49_15075) comA 2961429..2962073 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  KEF49_RS15080 (KEF49_15080) - 2962154..2964508 (-) 2355 Protein_2934 histidine kinase -
  KEF49_RS15085 (KEF49_15085) comX 2964486..2964656 (-) 171 WP_212099082.1 competence pheromone ComX -
  KEF49_RS15090 (KEF49_15090) comQ 2964671..2965579 (-) 909 WP_249199260.1 polyprenyl synthetase family protein Regulator
  KEF49_RS15095 (KEF49_15095) degQ 2965710..2965850 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  KEF49_RS15100 (KEF49_15100) - 2966315..2966656 (+) 342 WP_115997039.1 hypothetical protein -
  KEF49_RS15105 (KEF49_15105) - 2966662..2967885 (-) 1224 WP_115997038.1 EAL and HDOD domain-containing protein -
  KEF49_RS15110 (KEF49_15110) - 2968015..2969481 (-) 1467 WP_115997037.1 nicotinate phosphoribosyltransferase -
  KEF49_RS15115 (KEF49_15115) - 2969499..2970050 (-) 552 WP_212099085.1 isochorismatase family cysteine hydrolase -
  KEF49_RS15120 (KEF49_15120) - 2970131..2970526 (-) 396 WP_013353403.1 DUF1694 domain-containing protein -
  KEF49_RS15125 (KEF49_15125) - 2970592..2970840 (-) 249 WP_013353404.1 YueH family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=559614 KEF49_RS15095 WP_013353398.1 2965710..2965850(-) (degQ) [Bacillus amyloliquefaciens strain Ba13]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=559614 KEF49_RS15095 WP_013353398.1 2965710..2965850(-) (degQ) [Bacillus amyloliquefaciens strain Ba13]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913