Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KBP49_RS03080 | Genome accession | NZ_CP072933 |
| Coordinates | 713266..713712 (-) | Length | 148 a.a. |
| NCBI ID | WP_038210386.1 | Uniprot ID | A0AAW6HUM6 |
| Organism | Xylella fastidiosa subsp. multiplex strain AlmaEM3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 704048..728476 | 713266..713712 | within | 0 |
Gene organization within MGE regions
Location: 704048..728476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KBP49_RS03025 (KBP49_03025) | - | 704090..704674 (+) | 585 | WP_071869872.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| KBP49_RS03030 (KBP49_03030) | - | 704869..705510 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| KBP49_RS03035 (KBP49_03035) | - | 705507..706433 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| KBP49_RS03040 (KBP49_03040) | - | 706437..707267 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| KBP49_RS03045 (KBP49_03045) | - | 707273..708391 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| KBP49_RS03050 (KBP49_03050) | - | 708501..709763 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| KBP49_RS03055 (KBP49_03055) | - | 710404..710610 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| KBP49_RS03060 (KBP49_03060) | - | 710674..710886 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| KBP49_RS03065 (KBP49_03065) | - | 710950..711159 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| KBP49_RS03070 (KBP49_03070) | - | 711800..712972 (-) | 1173 | WP_038210388.1 | integrase | - |
| KBP49_RS03075 (KBP49_03075) | - | 712972..713244 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| KBP49_RS03080 (KBP49_03080) | ssb | 713266..713712 (-) | 447 | WP_038210386.1 | single-stranded DNA-binding protein | Machinery gene |
| KBP49_RS03085 (KBP49_03085) | - | 713696..714166 (-) | 471 | WP_071869857.1 | DUF5131 family protein | - |
| KBP49_RS03090 (KBP49_03090) | - | 714159..714389 (-) | 231 | WP_154415128.1 | hypothetical protein | - |
| KBP49_RS10915 | - | 714389..714712 (-) | 324 | WP_038210382.1 | hypothetical protein | - |
| KBP49_RS03100 (KBP49_03100) | - | 714805..715338 (-) | 534 | WP_081364569.1 | pilin | - |
| KBP49_RS03105 (KBP49_03105) | - | 715471..715737 (-) | 267 | WP_027700596.1 | hypothetical protein | - |
| KBP49_RS03110 (KBP49_03110) | - | 715734..716012 (-) | 279 | WP_027700595.1 | hypothetical protein | - |
| KBP49_RS03115 (KBP49_03115) | - | 716009..716230 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| KBP49_RS03120 (KBP49_03120) | - | 716227..716676 (-) | 450 | WP_038210363.1 | hypothetical protein | - |
| KBP49_RS03125 (KBP49_03125) | - | 716676..717134 (-) | 459 | WP_027700592.1 | DUF1566 domain-containing protein | - |
| KBP49_RS03130 (KBP49_03130) | - | 717131..717472 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| KBP49_RS10920 | - | 717599..718000 (+) | 402 | WP_247644830.1 | CHC2 zinc finger domain-containing protein | - |
| KBP49_RS03140 (KBP49_03140) | - | 717915..718580 (+) | 666 | WP_247644831.1 | terminase gpA endonuclease subunit | - |
| KBP49_RS03145 (KBP49_03145) | - | 718657..718893 (+) | 237 | WP_038228002.1 | hypothetical protein | - |
| KBP49_RS03150 (KBP49_03150) | - | 718890..719405 (+) | 516 | WP_140161019.1 | phage portal protein | - |
| KBP49_RS03155 (KBP49_03155) | - | 719522..719812 (+) | 291 | WP_081364557.1 | hypothetical protein | - |
| KBP49_RS11385 | - | 719826..719948 (+) | 123 | WP_324187556.1 | hypothetical protein | - |
| KBP49_RS03160 (KBP49_03160) | - | 719939..720367 (+) | 429 | WP_004086822.1 | hypothetical protein | - |
| KBP49_RS03165 (KBP49_03165) | - | 720364..720600 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| KBP49_RS03170 (KBP49_03170) | - | 720590..723415 (+) | 2826 | WP_140161020.1 | phage tail protein | - |
| KBP49_RS03175 (KBP49_03175) | - | 723408..723920 (+) | 513 | WP_071869936.1 | hypothetical protein | - |
| KBP49_RS03180 (KBP49_03180) | - | 723924..724343 (+) | 420 | WP_004087259.1 | hypothetical protein | - |
| KBP49_RS03185 (KBP49_03185) | - | 724452..725114 (+) | 663 | WP_247644576.1 | hypothetical protein | - |
| KBP49_RS11295 | - | 725174..725302 (-) | 129 | WP_256704593.1 | hypothetical protein | - |
| KBP49_RS03190 (KBP49_03190) | - | 725350..726141 (+) | 792 | WP_140161046.1 | DNA adenine methylase | - |
| KBP49_RS03195 (KBP49_03195) | - | 726397..726795 (-) | 399 | WP_027700038.1 | hypothetical protein | - |
| KBP49_RS03200 (KBP49_03200) | - | 726852..727151 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| KBP49_RS11300 | - | 727285..727416 (-) | 132 | WP_256704532.1 | hypothetical protein | - |
| KBP49_RS03205 (KBP49_03205) | - | 727511..727753 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| KBP49_RS03210 (KBP49_03210) | - | 728159..728476 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16508.32 Da Isoelectric Point: 6.4865
>NTDB_id=556906 KBP49_RS03080 WP_038210386.1 713266..713712(-) (ssb) [Xylella fastidiosa subsp. multiplex strain AlmaEM3]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=556906 KBP49_RS03080 WP_038210386.1 713266..713712(-) (ssb) [Xylella fastidiosa subsp. multiplex strain AlmaEM3]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.15 |
100 |
0.446 |
| ssb | Neisseria gonorrhoeae MS11 |
38.15 |
100 |
0.446 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |