Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J9312_RS16065 Genome accession   NZ_CP072845
Coordinates   2990209..2990349 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain XP     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2985209..2995349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J9312_RS16040 (J9312_15920) - 2985233..2986855 (-) 1623 Protein_3087 sensor histidine kinase -
  J9312_RS16045 (J9312_15925) - 2986953..2988200 (+) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  J9312_RS16050 (J9312_15930) - 2988158..2988922 (-) 765 WP_264379345.1 hypothetical protein -
  J9312_RS16055 (J9312_15935) comX 2988938..2989159 (-) 222 WP_014480704.1 competence pheromone ComX -
  J9312_RS16060 (J9312_15940) - 2989161..2990024 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  J9312_RS16065 (J9312_15945) degQ 2990209..2990349 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  J9312_RS16070 (J9312_15950) - 2990571..2990696 (+) 126 WP_003228793.1 hypothetical protein -
  J9312_RS16075 (J9312_15955) - 2990811..2991179 (+) 369 WP_046381300.1 hypothetical protein -
  J9312_RS16080 (J9312_15960) pdeH 2991155..2992384 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  J9312_RS16085 (J9312_15965) pncB 2992521..2993993 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  J9312_RS16090 (J9312_15970) pncA 2994009..2994560 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  J9312_RS16095 (J9312_15975) yueI 2994657..2995055 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=556225 J9312_RS16065 WP_003220708.1 2990209..2990349(-) (degQ) [Bacillus subtilis strain XP]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=556225 J9312_RS16065 WP_003220708.1 2990209..2990349(-) (degQ) [Bacillus subtilis strain XP]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1