Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | J9312_RS13120 | Genome accession | NZ_CP072845 |
| Coordinates | 2436827..2437237 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain XP | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2432193..2460123 | 2436827..2437237 | within | 0 |
Gene organization within MGE regions
Location: 2432193..2460123
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J9312_RS13095 (J9312_13015) | yqeF | 2432360..2433091 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| J9312_RS13100 (J9312_13020) | cwlH | 2433343..2434095 (-) | 753 | WP_264379321.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| J9312_RS13105 (J9312_13025) | yqeD | 2434282..2434908 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| J9312_RS13110 (J9312_13030) | gnd | 2434927..2435820 (-) | 894 | WP_069837643.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| J9312_RS13115 (J9312_13035) | yqeB | 2436072..2436794 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| J9312_RS13120 (J9312_13040) | nucA/comI | 2436827..2437237 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| J9312_RS13125 (J9312_13045) | sigK | 2437433..2438161 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| J9312_RS13130 (J9312_13050) | - | 2438161..2438259 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| J9312_RS13135 | - | 2438256..2438468 (-) | 213 | Protein_2537 | recombinase family protein | - |
| J9312_RS13140 (J9312_13060) | fumC | 2438687..2440075 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| J9312_RS13145 (J9312_13065) | - | 2440242..2441132 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| J9312_RS13150 (J9312_13070) | - | 2442074..2442469 (+) | 396 | WP_046160622.1 | VOC family protein | - |
| J9312_RS13160 (J9312_13075) | - | 2443209..2444336 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| J9312_RS21740 | - | 2444518..2445351 (+) | 834 | Protein_2542 | ribonuclease YeeF family protein | - |
| J9312_RS21745 | - | 2445773..2446444 (+) | 672 | WP_228224803.1 | hypothetical protein | - |
| J9312_RS13175 (J9312_13085) | - | 2446458..2446745 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| J9312_RS13180 (J9312_13090) | - | 2447148..2447588 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| J9312_RS13185 (J9312_13095) | - | 2447687..2448139 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| J9312_RS13190 (J9312_13100) | cdiI | 2448236..2448595 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| J9312_RS13195 (J9312_13105) | - | 2448700..2449179 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| J9312_RS13200 (J9312_13110) | - | 2449487..2449690 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| J9312_RS13205 (J9312_13115) | - | 2449779..2450012 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| J9312_RS13210 (J9312_13120) | atxG | 2450280..2450857 (+) | 578 | Protein_2551 | suppressor of fused domain protein | - |
| J9312_RS13215 (J9312_13125) | - | 2450967..2451257 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| J9312_RS13220 (J9312_13130) | istA | 2452098..2453645 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| J9312_RS13225 (J9312_13135) | istB | 2453642..2454400 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| J9312_RS21750 (J9312_13140) | - | 2454652..2454818 (-) | 167 | Protein_2555 | peptidoglycan-binding domain-containing protein | - |
| J9312_RS13235 (J9312_13145) | - | 2454993..2455079 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| J9312_RS21755 (J9312_13150) | - | 2455366..2455841 (-) | 476 | Protein_2557 | phage tail tube protein | - |
| J9312_RS13250 (J9312_13155) | terS | 2455801..2456365 (-) | 565 | Protein_2558 | phage terminase small subunit | - |
| J9312_RS13255 (J9312_13160) | - | 2456492..2456797 (+) | 306 | WP_264379322.1 | hypothetical protein | - |
| J9312_RS13265 (J9312_13165) | - | 2457190..2457669 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| J9312_RS13270 (J9312_13170) | - | 2458286..2458552 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| J9312_RS13275 (J9312_13175) | - | 2458691..2458843 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| J9312_RS13280 (J9312_13180) | - | 2458926..2459048 (-) | 123 | Protein_2563 | RusA family crossover junction endodeoxyribonuclease | - |
| J9312_RS13285 (J9312_13185) | - | 2459011..2459259 (-) | 249 | Protein_2564 | hypothetical protein | - |
| J9312_RS13290 | - | 2459404..2459634 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| J9312_RS13295 (J9312_13195) | - | 2459943..2460123 (-) | 181 | Protein_2566 | hypothetical protein | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=556215 J9312_RS13120 WP_009967785.1 2436827..2437237(-) (nucA/comI) [Bacillus subtilis strain XP]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=556215 J9312_RS13120 WP_009967785.1 2436827..2437237(-) (nucA/comI) [Bacillus subtilis strain XP]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |