Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   J8615_RS01925 Genome accession   NZ_CP072791
Coordinates   380306..380425 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain GS-1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375306..385425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8615_RS01910 (J8615_01910) - 376918..377601 (+) 684 WP_003156341.1 response regulator transcription factor -
  J8615_RS01915 (J8615_01915) - 377588..379021 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  J8615_RS01920 (J8615_01920) rapC 379174..380322 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  J8615_RS01925 (J8615_01925) phrC 380306..380425 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  J8615_RS01930 (J8615_01930) - 380576..380686 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  J8615_RS01935 (J8615_01935) - 380766..382130 (-) 1365 WP_060657805.1 aspartate kinase -
  J8615_RS01940 (J8615_01940) ceuB 382545..383498 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  J8615_RS01945 (J8615_01945) - 383488..384435 (+) 948 WP_219984691.1 iron chelate uptake ABC transporter family permease subunit -
  J8615_RS01950 (J8615_01950) - 384429..385187 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=555807 J8615_RS01925 WP_003156334.1 380306..380425(+) (phrC) [Bacillus velezensis strain GS-1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=555807 J8615_RS01925 WP_003156334.1 380306..380425(+) (phrC) [Bacillus velezensis strain GS-1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718