Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LT978_RS17930 Genome accession   NZ_CP090838
Coordinates   3592673..3592792 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain TL106     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3587673..3597792
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT978_RS17905 (LT978_17900) - 3587912..3588670 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  LT978_RS17910 (LT978_17905) - 3588664..3589611 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  LT978_RS17915 (LT978_17910) ceuB 3589601..3590554 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  LT978_RS17920 (LT978_17915) - 3590969..3592333 (+) 1365 WP_003156333.1 aspartate kinase -
  LT978_RS17925 (LT978_17920) - 3592428..3592523 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  LT978_RS17930 (LT978_17925) phrC 3592673..3592792 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LT978_RS17935 (LT978_17930) rapC 3592776..3593924 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  LT978_RS17940 (LT978_17935) - 3594077..3595510 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  LT978_RS17945 (LT978_17940) - 3595497..3596180 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=555738 LT978_RS17930 WP_003156334.1 3592673..3592792(-) (phrC) [Bacillus amyloliquefaciens strain TL106]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=555738 LT978_RS17930 WP_003156334.1 3592673..3592792(-) (phrC) [Bacillus amyloliquefaciens strain TL106]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718