Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   LT978_RS04605 Genome accession   NZ_CP090838
Coordinates   905907..906077 (+) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain TL106     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 900907..911077
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT978_RS04580 (LT978_04575) - 901057..902523 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  LT978_RS04585 (LT978_04580) - 902653..903873 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  LT978_RS04590 (LT978_04585) - 903880..904221 (-) 342 WP_014305721.1 hypothetical protein -
  LT978_RS04595 (LT978_04590) degQ 904687..904827 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LT978_RS04600 (LT978_04595) comQ 904958..905944 (+) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  LT978_RS04605 (LT978_04600) comX 905907..906077 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  LT978_RS04610 (LT978_04605) comP 906097..908400 (+) 2304 WP_003152050.1 histidine kinase Regulator
  LT978_RS04615 (LT978_04610) comA 908481..909125 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  LT978_RS04620 (LT978_04615) - 909147..909530 (+) 384 WP_003152054.1 hotdog fold thioesterase -
  LT978_RS04625 (LT978_04620) mnhG 909570..909944 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  LT978_RS04630 (LT978_04625) - 909928..910212 (-) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  LT978_RS04635 (LT978_04630) - 910212..910688 (-) 477 WP_003152059.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=555635 LT978_RS04605 WP_003152048.1 905907..906077(+) (comX) [Bacillus amyloliquefaciens strain TL106]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=555635 LT978_RS04605 WP_003152048.1 905907..906077(+) (comX) [Bacillus amyloliquefaciens strain TL106]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5