Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | J2N67_RS12815 | Genome accession | NZ_CP072691 |
| Coordinates | 2507059..2507337 (-) | Length | 92 a.a. |
| NCBI ID | WP_046945298.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis strain IMBL-B9 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2475202..2517139 | 2507059..2507337 | within | 0 |
Gene organization within MGE regions
Location: 2475202..2517139
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J2N67_RS12610 (J2N67_002523) | - | 2475202..2476011 (-) | 810 | WP_000529740.1 | GH25 family lysozyme | - |
| J2N67_RS12615 (J2N67_002524) | - | 2476011..2476430 (-) | 420 | WP_088065313.1 | phage holin family protein | - |
| J2N67_RS12620 (J2N67_002525) | - | 2476446..2477405 (-) | 960 | WP_142286137.1 | site-specific integrase | - |
| J2N67_RS12625 (J2N67_002526) | - | 2477507..2477881 (-) | 375 | WP_087947553.1 | hypothetical protein | - |
| J2N67_RS12630 (J2N67_002527) | - | 2477897..2482291 (-) | 4395 | WP_252597829.1 | phage tail spike protein | - |
| J2N67_RS12635 (J2N67_002528) | - | 2482288..2483757 (-) | 1470 | WP_252597830.1 | distal tail protein Dit | - |
| J2N67_RS12640 (J2N67_002529) | - | 2483797..2488794 (-) | 4998 | WP_088065323.1 | phage tail tape measure protein | - |
| J2N67_RS12645 (J2N67_002530) | - | 2488959..2489333 (-) | 375 | WP_015382157.1 | hypothetical protein | - |
| J2N67_RS12650 (J2N67_002531) | - | 2489390..2489974 (-) | 585 | WP_088065322.1 | major tail protein | - |
| J2N67_RS12655 (J2N67_002532) | - | 2489990..2490352 (-) | 363 | WP_000793436.1 | DUF3168 domain-containing protein | - |
| J2N67_RS12660 (J2N67_002533) | - | 2490349..2490786 (-) | 438 | WP_000818829.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| J2N67_RS12665 (J2N67_002534) | - | 2490774..2491148 (-) | 375 | WP_001182260.1 | phage head closure protein | - |
| J2N67_RS12670 (J2N67_002535) | - | 2491150..2491446 (-) | 297 | WP_086406885.1 | hypothetical protein | - |
| J2N67_RS12675 (J2N67_002536) | - | 2491459..2492622 (-) | 1164 | WP_252597831.1 | phage major capsid protein | - |
| J2N67_RS12680 (J2N67_002537) | - | 2492642..2493418 (-) | 777 | WP_252597832.1 | head maturation protease, ClpP-related | - |
| J2N67_RS12685 (J2N67_002538) | - | 2493402..2494508 (-) | 1107 | WP_088065334.1 | phage portal protein | - |
| J2N67_RS12690 (J2N67_002539) | - | 2494574..2496232 (-) | 1659 | WP_088065325.1 | terminase TerL endonuclease subunit | - |
| J2N67_RS12695 (J2N67_002540) | - | 2496229..2496564 (-) | 336 | WP_000124846.1 | P27 family phage terminase small subunit | - |
| J2N67_RS12700 (J2N67_002541) | - | 2496715..2497050 (-) | 336 | WP_088065326.1 | HNH endonuclease | - |
| J2N67_RS12705 (J2N67_002542) | - | 2497043..2497273 (-) | 231 | WP_088065327.1 | hypothetical protein | - |
| J2N67_RS12710 (J2N67_002543) | - | 2497278..2497595 (-) | 318 | WP_088065328.1 | hypothetical protein | - |
| J2N67_RS12715 (J2N67_002544) | - | 2497685..2498050 (-) | 366 | WP_088065329.1 | hypothetical protein | - |
| J2N67_RS12720 (J2N67_002545) | - | 2498668..2499210 (-) | 543 | WP_088065330.1 | site-specific integrase | - |
| J2N67_RS12725 (J2N67_002546) | - | 2499210..2499692 (-) | 483 | WP_088065331.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| J2N67_RS12730 (J2N67_002547) | - | 2499720..2499890 (-) | 171 | WP_000677276.1 | hypothetical protein | - |
| J2N67_RS12735 (J2N67_002548) | - | 2500186..2501379 (+) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| J2N67_RS12740 (J2N67_002549) | - | 2501580..2501699 (-) | 120 | WP_088065332.1 | DUF3983 domain-containing protein | - |
| J2N67_RS12745 (J2N67_002550) | - | 2501939..2502109 (-) | 171 | WP_187298996.1 | hypothetical protein | - |
| J2N67_RS12750 (J2N67_002551) | - | 2502132..2502380 (-) | 249 | WP_252597833.1 | helix-turn-helix transcriptional regulator | - |
| J2N67_RS12755 (J2N67_002552) | - | 2502479..2502745 (-) | 267 | WP_042973207.1 | hypothetical protein | - |
| J2N67_RS12760 (J2N67_002553) | - | 2502856..2503086 (-) | 231 | WP_252597834.1 | hypothetical protein | - |
| J2N67_RS12765 (J2N67_002554) | - | 2503118..2503414 (-) | 297 | WP_144543993.1 | hypothetical protein | - |
| J2N67_RS12770 (J2N67_002555) | - | 2503458..2503703 (-) | 246 | WP_106103581.1 | hypothetical protein | - |
| J2N67_RS12775 (J2N67_002556) | - | 2503740..2504138 (-) | 399 | WP_033698090.1 | hypothetical protein | - |
| J2N67_RS12780 (J2N67_002557) | - | 2504282..2504449 (-) | 168 | WP_170921856.1 | hypothetical protein | - |
| J2N67_RS12785 (J2N67_002558) | - | 2504857..2505261 (-) | 405 | WP_033698088.1 | YopX family protein | - |
| J2N67_RS12790 (J2N67_002559) | - | 2505422..2505676 (-) | 255 | WP_033698086.1 | hypothetical protein | - |
| J2N67_RS12795 (J2N67_002560) | - | 2505715..2506224 (-) | 510 | WP_088065305.1 | dUTP diphosphatase | - |
| J2N67_RS12800 (J2N67_002561) | - | 2506244..2506495 (-) | 252 | WP_000109542.1 | hypothetical protein | - |
| J2N67_RS12805 (J2N67_002562) | - | 2506521..2506688 (-) | 168 | WP_088065306.1 | DUF3954 domain-containing protein | - |
| J2N67_RS12810 (J2N67_002563) | - | 2506707..2507066 (-) | 360 | WP_001118819.1 | hypothetical protein | - |
| J2N67_RS12815 (J2N67_002564) | abrB | 2507059..2507337 (-) | 279 | WP_046945298.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| J2N67_RS12820 (J2N67_002565) | - | 2507354..2507548 (-) | 195 | WP_049106862.1 | hypothetical protein | - |
| J2N67_RS12825 (J2N67_002566) | - | 2507564..2508439 (-) | 876 | WP_252597835.1 | ATP-binding protein | - |
| J2N67_RS12830 (J2N67_002567) | - | 2508378..2509124 (-) | 747 | WP_088065309.1 | DnaD domain protein | - |
| J2N67_RS12835 (J2N67_002568) | - | 2509129..2509305 (-) | 177 | WP_086406898.1 | hypothetical protein | - |
| J2N67_RS12840 (J2N67_002569) | - | 2509335..2509502 (-) | 168 | WP_016097575.1 | hypothetical protein | - |
| J2N67_RS12845 (J2N67_002570) | - | 2509499..2509849 (-) | 351 | WP_088065310.1 | helix-turn-helix domain-containing protein | - |
| J2N67_RS12850 (J2N67_002571) | - | 2509894..2510625 (-) | 732 | WP_088065311.1 | ORF6C domain-containing protein | - |
| J2N67_RS12855 (J2N67_002572) | - | 2510641..2510862 (-) | 222 | WP_046945305.1 | helix-turn-helix transcriptional regulator | - |
| J2N67_RS12860 (J2N67_002573) | - | 2511038..2511379 (+) | 342 | WP_046945306.1 | helix-turn-helix transcriptional regulator | - |
| J2N67_RS33580 (J2N67_002574) | - | 2511406..2511540 (-) | 135 | WP_080345667.1 | hypothetical protein | - |
| J2N67_RS12865 (J2N67_002575) | - | 2511700..2511852 (-) | 153 | WP_160309573.1 | hypothetical protein | - |
| J2N67_RS12870 (J2N67_002576) | - | 2511893..2513050 (-) | 1158 | WP_252597836.1 | AimR family lysis-lysogeny pheromone receptor | - |
| J2N67_RS12875 (J2N67_002577) | - | 2513541..2513888 (+) | 348 | WP_046945621.1 | helix-turn-helix transcriptional regulator | - |
| J2N67_RS33720 | - | 2514731..2515243 (+) | 513 | Protein_2546 | hypothetical protein | - |
| J2N67_RS12885 (J2N67_002579) | - | 2515682..2515840 (-) | 159 | WP_174402529.1 | hypothetical protein | - |
| J2N67_RS12890 (J2N67_002580) | - | 2516015..2517139 (+) | 1125 | WP_086412636.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10075.68 Da Isoelectric Point: 7.1683
>NTDB_id=555193 J2N67_RS12815 WP_046945298.1 2507059..2507337(-) (abrB) [Bacillus thuringiensis strain IMBL-B9]
MKNTGVVRKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKPEKSCFVTGKVSDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
MKNTGVVRKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKPEKSCFVTGKVSDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHG
Nucleotide
Download Length: 279 bp
>NTDB_id=555193 J2N67_RS12815 WP_046945298.1 2507059..2507337(-) (abrB) [Bacillus thuringiensis strain IMBL-B9]
ATGAAAAATACAGGTGTTGTAAGAAAAGTGGACGAGCTAGGGCGAGTAGTAATTCCAGTTGAGTTACGTAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTAAAGTATCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
ATGAAAAATACAGGTGTTGTAAGAAAAGTGGACGAGCTAGGGCGAGTAGTAATTCCAGTTGAGTTACGTAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTAAAGTATCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.242 |
98.913 |
0.576 |