Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J8G07_RS11575 Genome accession   NZ_CP072612
Coordinates   2238435..2238608 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain G10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2233435..2243608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8G07_RS11525 comGD 2233554..2233991 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  J8G07_RS11530 comGE 2233975..2234289 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  J8G07_RS11535 comGF 2234294..2234698 (+) 405 WP_235588110.1 competence type IV pilus minor pilin ComGF -
  J8G07_RS11540 comGG 2234699..2235076 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  J8G07_RS11545 - 2235133..2235312 (+) 180 WP_022552966.1 YqzE family protein -
  J8G07_RS11550 - 2235353..2235682 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  J8G07_RS11555 tapA 2235941..2236612 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  J8G07_RS11560 - 2236584..2237168 (+) 585 WP_032874025.1 signal peptidase I -
  J8G07_RS11565 - 2237233..2238018 (+) 786 WP_032874027.1 TasA family protein -
  J8G07_RS11570 sinR 2238066..2238401 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J8G07_RS11575 sinI 2238435..2238608 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  J8G07_RS11580 - 2238785..2239579 (-) 795 WP_007612541.1 YqhG family protein -
  J8G07_RS11585 - 2239601..2241271 (-) 1671 WP_032874031.1 SNF2-related protein -
  J8G07_RS11590 gcvT 2241694..2242794 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=554635 J8G07_RS11575 WP_032874029.1 2238435..2238608(-) (sinI) [Bacillus amyloliquefaciens strain G10]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=554635 J8G07_RS11575 WP_032874029.1 2238435..2238608(-) (sinI) [Bacillus amyloliquefaciens strain G10]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719