Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J8G07_RS08495 Genome accession   NZ_CP072612
Coordinates   1675846..1675986 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain G10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1670846..1680986
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8G07_RS08465 - 1671149..1671547 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  J8G07_RS08470 - 1671644..1672195 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  J8G07_RS08475 - 1672213..1673679 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  J8G07_RS08480 - 1673809..1675032 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  J8G07_RS08485 - 1675039..1675380 (-) 342 WP_032876795.1 hypothetical protein -
  J8G07_RS08495 degQ 1675846..1675986 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  J8G07_RS08500 - 1676194..1677054 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  J8G07_RS08505 comX 1677023..1677196 (+) 174 WP_012118314.1 competence pheromone ComX -
  J8G07_RS08510 comP 1677210..1679510 (+) 2301 WP_032876801.1 histidine kinase Regulator
  J8G07_RS08515 comA 1679591..1680235 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  J8G07_RS08520 - 1680257..1680640 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=554613 J8G07_RS08495 WP_003152043.1 1675846..1675986(+) (degQ) [Bacillus amyloliquefaciens strain G10]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=554613 J8G07_RS08495 WP_003152043.1 1675846..1675986(+) (degQ) [Bacillus amyloliquefaciens strain G10]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891