Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | LXM91_RS15015 | Genome accession | NZ_CP090477 |
| Coordinates | 3035965..3036105 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain W0101 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3030965..3041105
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LXM91_RS14990 (LXM91_14990) | - | 3031305..3031688 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| LXM91_RS14995 (LXM91_14995) | comA | 3031710..3032354 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| LXM91_RS15000 (LXM91_15000) | comP | 3032435..3034726 (-) | 2292 | WP_039254056.1 | histidine kinase | Regulator |
| LXM91_RS15005 (LXM91_15005) | comX | 3034738..3034902 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| LXM91_RS15010 (LXM91_15010) | comQ | 3034902..3035813 (-) | 912 | WP_031378407.1 | polyprenyl synthetase family protein | Regulator |
| LXM91_RS15015 (LXM91_15015) | degQ | 3035965..3036105 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| LXM91_RS15020 (LXM91_15020) | - | 3036571..3036912 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| LXM91_RS15025 (LXM91_15025) | - | 3036919..3038139 (-) | 1221 | WP_039254052.1 | EAL and HDOD domain-containing protein | - |
| LXM91_RS15030 (LXM91_15030) | - | 3038269..3039735 (-) | 1467 | WP_099686880.1 | nicotinate phosphoribosyltransferase | - |
| LXM91_RS15035 (LXM91_15035) | - | 3039753..3040304 (-) | 552 | WP_025853916.1 | isochorismatase family cysteine hydrolase | - |
| LXM91_RS15040 (LXM91_15040) | - | 3040401..3040799 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=554307 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=554307 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |