Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LXM91_RS15015 Genome accession   NZ_CP090477
Coordinates   3035965..3036105 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain W0101     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3030965..3041105
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXM91_RS14990 (LXM91_14990) - 3031305..3031688 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  LXM91_RS14995 (LXM91_14995) comA 3031710..3032354 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  LXM91_RS15000 (LXM91_15000) comP 3032435..3034726 (-) 2292 WP_039254056.1 histidine kinase Regulator
  LXM91_RS15005 (LXM91_15005) comX 3034738..3034902 (-) 165 WP_007613432.1 competence pheromone ComX -
  LXM91_RS15010 (LXM91_15010) comQ 3034902..3035813 (-) 912 WP_031378407.1 polyprenyl synthetase family protein Regulator
  LXM91_RS15015 (LXM91_15015) degQ 3035965..3036105 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LXM91_RS15020 (LXM91_15020) - 3036571..3036912 (+) 342 WP_014305721.1 hypothetical protein -
  LXM91_RS15025 (LXM91_15025) - 3036919..3038139 (-) 1221 WP_039254052.1 EAL and HDOD domain-containing protein -
  LXM91_RS15030 (LXM91_15030) - 3038269..3039735 (-) 1467 WP_099686880.1 nicotinate phosphoribosyltransferase -
  LXM91_RS15035 (LXM91_15035) - 3039753..3040304 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  LXM91_RS15040 (LXM91_15040) - 3040401..3040799 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=554307 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=554307 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891