Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LXM91_RS01990 Genome accession   NZ_CP090477
Coordinates   392893..393012 (+) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain W0101     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 387893..398012
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXM91_RS01975 (LXM91_01975) - 389516..390199 (+) 684 WP_007410267.1 response regulator transcription factor -
  LXM91_RS01980 (LXM91_01980) - 390186..391619 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  LXM91_RS01985 (LXM91_01985) rapC 391761..392909 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  LXM91_RS01990 (LXM91_01990) phrC 392893..393012 (+) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LXM91_RS01995 (LXM91_01995) - 393161..393256 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  LXM91_RS02000 (LXM91_02000) - 393351..394715 (-) 1365 WP_039252794.1 aspartate kinase -
  LXM91_RS02005 (LXM91_02005) ceuB 395129..396082 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  LXM91_RS02010 (LXM91_02010) - 396072..397019 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  LXM91_RS02015 (LXM91_02015) - 397013..397771 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=554207 LXM91_RS01990 WP_031378677.1 392893..393012(+) (phrC) [Bacillus amyloliquefaciens strain W0101]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=554207 LXM91_RS01990 WP_031378677.1 392893..393012(+) (phrC) [Bacillus amyloliquefaciens strain W0101]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769