Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   J7T61_RS07810 Genome accession   NZ_CP072441
Coordinates   1486623..1487699 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain S24728     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1471894..1544679 1486623..1487699 within 0


Gene organization within MGE regions


Location: 1471894..1544679
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7T61_RS07740 (J7T61_07695) - 1472785..1473336 (-) 552 WP_084826114.1 cysteine hydrolase family protein -
  J7T61_RS07745 (J7T61_07700) codY 1473399..1474184 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  J7T61_RS07750 (J7T61_07705) - 1474444..1475658 (-) 1215 WP_002951721.1 pyridoxal phosphate-dependent aminotransferase -
  J7T61_RS07755 (J7T61_07710) - 1476013..1476465 (+) 453 WP_002946987.1 universal stress protein -
  J7T61_RS07760 - 1476645..1477216 (+) 572 Protein_1475 IS30 family transposase -
  J7T61_RS07765 - 1477288..1477884 (-) 597 WP_232086461.1 hypothetical protein -
  J7T61_RS07770 (J7T61_07720) pflA 1478096..1478896 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  J7T61_RS07775 (J7T61_07725) - 1479084..1479194 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  J7T61_RS07780 (J7T61_07730) - 1479892..1481223 (-) 1332 WP_002946973.1 hemolysin family protein -
  J7T61_RS07785 (J7T61_07735) - 1481334..1482116 (+) 783 WP_372429335.1 ABC transporter ATP-binding protein -
  J7T61_RS07790 (J7T61_07740) - 1482735..1484801 (-) 2067 WP_138496610.1 sodium:proton antiporter -
  J7T61_RS07795 (J7T61_07745) - 1484810..1485052 (-) 243 WP_084830769.1 hypothetical protein -
  J7T61_RS07800 (J7T61_07750) - 1485049..1485597 (-) 549 WP_011226462.1 class I SAM-dependent methyltransferase -
  J7T61_RS07805 (J7T61_07755) - 1485594..1486538 (-) 945 WP_138496612.1 TIGR01212 family radical SAM protein -
  J7T61_RS07810 (J7T61_07760) sepM 1486623..1487699 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  J7T61_RS07815 (J7T61_07765) coaD 1487677..1488174 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  J7T61_RS07820 (J7T61_07770) rsmD 1488208..1488807 (-) 600 Protein_1487 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  J7T61_RS07825 (J7T61_07775) trxB 1488898..1489851 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  J7T61_RS07830 (J7T61_07780) - 1489884..1490108 (-) 225 WP_014621911.1 DUF4059 family protein -
  J7T61_RS07835 (J7T61_07785) - 1490323..1491066 (-) 744 WP_014608652.1 amino acid ABC transporter ATP-binding protein -
  J7T61_RS07840 (J7T61_07790) - 1491066..1491812 (-) 747 WP_100284797.1 amino acid ABC transporter permease -
  J7T61_RS07845 (J7T61_07795) - 1492200..1493030 (-) 831 WP_014608653.1 transporter substrate-binding domain-containing protein -
  J7T61_RS07850 (J7T61_07800) - 1493490..1493723 (-) 234 WP_002947030.1 hypothetical protein -
  J7T61_RS07855 (J7T61_07805) dinB 1494021..1495124 (-) 1104 WP_014608654.1 DNA polymerase IV -
  J7T61_RS07860 (J7T61_07810) pflB 1495403..1497712 (+) 2310 WP_011226473.1 formate C-acetyltransferase -
  J7T61_RS07865 (J7T61_07815) - 1497979..1498761 (+) 783 WP_011681555.1 carbonic anhydrase -
  J7T61_RS07870 (J7T61_07820) - 1498812..1499264 (+) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  J7T61_RS07875 (J7T61_07825) - 1499615..1499920 (-) 306 WP_372429342.1 restriction endonuclease subunit S -
  J7T61_RS07880 (J7T61_07830) mobV 1499945..1500453 (-) 509 Protein_1499 MobV family relaxase -
  J7T61_RS07885 (J7T61_07835) fetB 1500898..1501653 (-) 756 WP_372429344.1 iron export ABC transporter permease subunit FetB -
  J7T61_RS07890 (J7T61_07840) - 1501650..1502300 (-) 651 WP_011681559.1 ATP-binding cassette domain-containing protein -
  J7T61_RS07895 (J7T61_07845) - 1502503..1503459 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  J7T61_RS07900 (J7T61_07850) - 1503459..1504214 (-) 756 WP_011681560.1 CppA family protein -
  J7T61_RS07905 (J7T61_07855) - 1504496..1504858 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  J7T61_RS07910 (J7T61_07860) gla 1504945..1505808 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  J7T61_RS07915 (J7T61_07865) - 1505929..1508196 (+) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  J7T61_RS07920 (J7T61_07870) - 1508276..1508656 (-) 381 WP_002951783.1 hypothetical protein -
  J7T61_RS07925 (J7T61_07875) - 1508781..1509044 (-) 264 WP_372429348.1 hypothetical protein -
  J7T61_RS07930 (J7T61_07880) - 1509366..1509662 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  J7T61_RS07935 (J7T61_07885) - 1509827..1510033 (-) 207 WP_011681562.1 hypothetical protein -
  J7T61_RS07940 (J7T61_07890) - 1510064..1510756 (-) 693 WP_224103184.1 thioredoxin family protein -
  J7T61_RS07945 (J7T61_07895) - 1510947..1512514 (+) 1568 Protein_1512 IS3-like element ISSth1b family transposase -
  J7T61_RS07950 (J7T61_07900) - 1512660..1512914 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  J7T61_RS07955 - 1513165..1513566 (-) 402 WP_024703992.1 hypothetical protein -
  J7T61_RS07960 (J7T61_07905) - 1514571..1514801 (-) 231 WP_260223024.1 bacteriocin class II family protein -
  J7T61_RS07965 (J7T61_07910) - 1515157..1515357 (-) 201 WP_011681569.1 hypothetical protein -
  J7T61_RS07970 (J7T61_07915) - 1515376..1515552 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  J7T61_RS07975 (J7T61_07920) - 1515803..1516540 (+) 738 WP_011681571.1 LytTR family DNA-binding domain-containing protein -
  J7T61_RS07980 - 1517071..1517688 (+) 618 WP_372429353.1 GHKL domain-containing protein -
  J7T61_RS07985 - 1517606..1517881 (+) 276 WP_372429355.1 GHKL domain-containing protein -
  J7T61_RS07990 (J7T61_07930) - 1517899..1518060 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  J7T61_RS07995 (J7T61_07935) - 1518075..1519442 (-) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  J7T61_RS08000 (J7T61_07940) - 1519458..1521610 (-) 2153 Protein_1523 peptide cleavage/export ABC transporter -
  J7T61_RS08005 (J7T61_07950) - 1522624..1524369 (-) 1746 WP_372429357.1 ABC transporter ATP-binding protein -
  J7T61_RS08010 (J7T61_07955) - 1524362..1526119 (-) 1758 WP_014608668.1 ABC transporter ATP-binding protein -
  J7T61_RS08015 - 1526307..1526513 (-) 207 WP_002948879.1 hypothetical protein -
  J7T61_RS08020 (J7T61_07965) - 1526717..1527244 (-) 528 WP_011226503.1 VanZ family protein -
  J7T61_RS08025 (J7T61_07970) rlmN 1527246..1528415 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  J7T61_RS08030 (J7T61_07975) - 1528419..1529141 (-) 723 WP_011226505.1 YutD family protein -
  J7T61_RS08035 (J7T61_07980) - 1529196..1530551 (-) 1356 WP_002948886.1 bifunctional UDP-sugar hydrolase/5'-nucleotidase -
  J7T61_RS08040 (J7T61_07985) - 1531399..1532742 (-) 1344 WP_372429364.1 DEAD/DEAH box helicase -
  J7T61_RS08045 (J7T61_07990) mraY 1532817..1533839 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  J7T61_RS08050 (J7T61_07995) pbp2X 1533841..1536108 (-) 2268 WP_372429366.1 penicillin-binding protein PBP2X -
  J7T61_RS08055 (J7T61_08000) ftsL 1536112..1536432 (-) 321 WP_014608671.1 cell division protein FtsL -
  J7T61_RS08060 (J7T61_08005) rsmH 1536435..1537385 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  J7T61_RS08065 (J7T61_08010) - 1537552..1538286 (-) 735 WP_224103476.1 hypothetical protein -
  J7T61_RS08070 (J7T61_08020) - 1538612..1538875 (+) 264 WP_162877224.1 hypothetical protein -
  J7T61_RS08075 (J7T61_08025) - 1539181..1539537 (-) 357 WP_023909925.1 DUF805 domain-containing protein -
  J7T61_RS08080 (J7T61_08030) - 1539886..1540053 (-) 168 WP_153300736.1 hypothetical protein -
  J7T61_RS08085 (J7T61_08035) - 1540386..1541636 (-) 1251 WP_014608675.1 glutamate-5-semialdehyde dehydrogenase -
  J7T61_RS08090 (J7T61_08040) proB 1541638..1542441 (-) 804 WP_014608676.1 glutamate 5-kinase -
  J7T61_RS08095 (J7T61_08045) - 1542562..1544151 (-) 1590 WP_014608677.1 ABC transporter permease -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=553296 J7T61_RS07810 WP_011681549.1 1486623..1487699(-) (sepM) [Streptococcus thermophilus strain S24728]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=553296 J7T61_RS07810 WP_011681549.1 1486623..1487699(-) (sepM) [Streptococcus thermophilus strain S24728]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

PDZ domain (PDZ_2)

(137-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598