Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | LXA49_RS02860 | Genome accession | NZ_CP089949 |
| Coordinates | 546527..546676 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain SN75752 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 541527..551676
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LXA49_RS11215 | comA/nlmT | 541573..542160 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| LXA49_RS02815 (LXA49_02810) | blpI | 542442..542639 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| LXA49_RS02820 (LXA49_02815) | blpJ | 543106..543375 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| LXA49_RS02825 (LXA49_02820) | blpU | 543444..543674 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| LXA49_RS02830 (LXA49_02825) | - | 543677..543796 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| LXA49_RS02835 (LXA49_02830) | - | 544093..544257 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| LXA49_RS02840 (LXA49_02835) | - | 544254..544658 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| LXA49_RS02845 (LXA49_02840) | - | 544856..545660 (+) | 805 | Protein_568 | IS5 family transposase | - |
| LXA49_RS02850 (LXA49_02845) | blpM | 545810..546064 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| LXA49_RS02855 (LXA49_02850) | blpN | 546080..546283 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| LXA49_RS02860 (LXA49_02855) | cipB | 546527..546676 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| LXA49_RS02865 (LXA49_02860) | - | 546780..546899 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| LXA49_RS02870 (LXA49_02865) | - | 547685..548104 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| LXA49_RS02875 (LXA49_02870) | - | 548119..548808 (+) | 690 | WP_000760521.1 | CPBP family intramembrane glutamic endopeptidase | - |
| LXA49_RS02880 (LXA49_02875) | blpZ | 548850..549083 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| LXA49_RS02885 (LXA49_02880) | - | 549414..550760 (+) | 1347 | WP_001808790.1 | IS1380-like element ISSpn5 family transposase | - |
| LXA49_RS02890 (LXA49_02885) | - | 550942..551553 (+) | 612 | WP_000638370.1 | type II CAAX endopeptidase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=552780 LXA49_RS02860 WP_001809846.1 546527..546676(+) (cipB) [Streptococcus pneumoniae strain SN75752]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=552780 LXA49_RS02860 WP_001809846.1 546527..546676(+) (cipB) [Streptococcus pneumoniae strain SN75752]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |