Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   A7A1_RS14720 Genome accession   NC_019896
Coordinates   2867657..2867848 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis str. BSP1     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 2862657..2872848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A7A1_RS14695 (A7A1_0953) appD 2862980..2863966 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  A7A1_RS14700 (A7A1_0952) yjaZ 2864158..2864944 (-) 787 Protein_2913 DUF2268 domain-containing protein -
  A7A1_RS14705 (A7A1_0951) fabF 2865021..2866262 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  A7A1_RS14710 (A7A1_0950) fabH 2866285..2867223 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  A7A1_RS14715 (A7A1_0949) yjzB 2867388..2867627 (+) 240 WP_003232972.1 spore coat protein YjzB -
  A7A1_RS14720 (A7A1_0948) comZ 2867657..2867848 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  A7A1_RS14725 (A7A1_0947) med 2867863..2868816 (-) 954 WP_014476425.1 transcriptional regulator Med Regulator
  A7A1_RS14730 (A7A1_0946) - 2868906..2869463 (-) 558 WP_015252365.1 hypothetical protein -
  A7A1_RS14735 (A7A1_0945) - 2869545..2870279 (-) 735 WP_003245223.1 hypothetical protein -
  A7A1_RS14740 (A7A1_0944) yjzD 2870527..2870712 (+) 186 WP_003245236.1 DUF2929 domain-containing protein -
  A7A1_RS14745 (A7A1_0943) yjzC 2870758..2870937 (-) 180 WP_003245356.1 YjzC family protein -
  A7A1_RS14750 (A7A1_0942) argF 2870975..2871982 (-) 1008 WP_015252366.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=55258 A7A1_RS14720 WP_003224559.1 2867657..2867848(-) (comZ) [Bacillus subtilis subsp. subtilis str. BSP1]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=55258 A7A1_RS14720 WP_003224559.1 2867657..2867848(-) (comZ) [Bacillus subtilis subsp. subtilis str. BSP1]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment