Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LUV29_RS17220 Genome accession   NZ_CP089592
Coordinates   3261689..3261829 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain Bsi     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3256689..3266829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUV29_RS17195 (LUV29_17195) yuxO 3257003..3257383 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  LUV29_RS17200 (LUV29_17200) comA 3257402..3258046 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  LUV29_RS17205 (LUV29_17205) comP 3258127..3260435 (-) 2309 Protein_3329 two-component system sensor histidine kinase ComP -
  LUV29_RS17210 (LUV29_17210) comX 3260450..3260617 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  LUV29_RS17215 (LUV29_17215) comQ 3260605..3261504 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  LUV29_RS17220 (LUV29_17220) degQ 3261689..3261829 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LUV29_RS17225 (LUV29_17225) - 3262051..3262176 (+) 126 WP_003228793.1 hypothetical protein -
  LUV29_RS17230 (LUV29_17230) - 3262290..3262658 (+) 369 WP_003243784.1 hypothetical protein -
  LUV29_RS17235 (LUV29_17235) pdeH 3262634..3263863 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  LUV29_RS17240 (LUV29_17240) pncB 3264000..3265472 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  LUV29_RS17245 (LUV29_17245) pncA 3265488..3266039 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  LUV29_RS17250 (LUV29_17250) yueI 3266136..3266534 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=552257 LUV29_RS17220 WP_003220708.1 3261689..3261829(-) (degQ) [Bacillus subtilis strain Bsi]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=552257 LUV29_RS17220 WP_003220708.1 3261689..3261829(-) (degQ) [Bacillus subtilis strain Bsi]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1