Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   J5V93_RS13810 Genome accession   NZ_CP072061
Coordinates   2713516..2713794 (-) Length   92 a.a.
NCBI ID   WP_215563512.1    Uniprot ID   -
Organism   Bacillus mycoides strain JAS06/1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2670858..2712939 2713516..2713794 flank 577


Gene organization within MGE regions


Location: 2670858..2713794
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5V93_RS13545 (J5V93_13545) - 2671927..2673093 (-) 1167 WP_002127946.1 serine hydrolase domain-containing protein -
  J5V93_RS13550 (J5V93_13550) - 2673518..2674024 (-) 507 WP_002127948.1 DUF3902 family protein -
  J5V93_RS13555 (J5V93_13555) - 2674374..2675108 (-) 735 WP_016127189.1 hypothetical protein -
  J5V93_RS13560 (J5V93_13560) - 2675124..2676233 (-) 1110 WP_001075915.1 DUF58 domain-containing protein -
  J5V93_RS13565 (J5V93_13565) - 2676230..2677162 (-) 933 WP_215563481.1 MoxR family ATPase -
  J5V93_RS13570 (J5V93_13570) - 2677309..2677602 (-) 294 WP_000583822.1 putative quinol monooxygenase -
  J5V93_RS13575 (J5V93_13575) - 2677649..2678287 (-) 639 WP_000185377.1 nitroreductase family protein -
  J5V93_RS13580 (J5V93_13580) - 2678306..2678734 (-) 429 WP_000204168.1 MarR family transcriptional regulator -
  J5V93_RS13585 (J5V93_13585) - 2679025..2680968 (+) 1944 WP_002127951.1 TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein -
  J5V93_RS13590 (J5V93_13590) - 2681016..2681660 (-) 645 WP_088045036.1 alpha/beta hydrolase -
  J5V93_RS13595 (J5V93_13595) - 2681847..2682467 (-) 621 WP_215563482.1 replication-relaxation family protein -
  J5V93_RS13600 (J5V93_13600) - 2682409..2683593 (-) 1185 WP_215563483.1 FtsK/SpoIIIE domain-containing protein -
  J5V93_RS13605 (J5V93_13605) - 2683709..2683891 (-) 183 WP_050821861.1 hypothetical protein -
  J5V93_RS13610 (J5V93_13610) - 2683894..2684196 (-) 303 WP_050000558.1 hypothetical protein -
  J5V93_RS13615 (J5V93_13615) - 2684380..2684601 (+) 222 WP_050000557.1 helix-turn-helix transcriptional regulator -
  J5V93_RS13620 (J5V93_13620) - 2684594..2685085 (+) 492 WP_215563484.1 hypothetical protein -
  J5V93_RS13625 (J5V93_13625) - 2685140..2685226 (-) 87 Protein_2706 N-acetylmuramoyl-L-alanine amidase C-terminal domain-containing protein -
  J5V93_RS13630 (J5V93_13630) - 2685399..2685752 (+) 354 WP_215563485.1 YolD-like family protein -
  J5V93_RS13635 (J5V93_13635) - 2685784..2686848 (-) 1065 WP_215563486.1 N-acetylmuramoyl-L-alanine amidase -
  J5V93_RS13640 (J5V93_13640) - 2686845..2687084 (-) 240 WP_088009803.1 holin -
  J5V93_RS13645 (J5V93_13645) - 2687084..2687320 (-) 237 WP_215563487.1 hemolysin XhlA family protein -
  J5V93_RS13650 (J5V93_13650) - 2687406..2688161 (-) 756 WP_215563488.1 DUF2971 domain-containing protein -
  J5V93_RS13655 (J5V93_13655) - 2688288..2693039 (-) 4752 WP_215563489.1 phage tail spike protein -
  J5V93_RS13660 (J5V93_13660) - 2693036..2694532 (-) 1497 WP_215563490.1 distal tail protein Dit -
  J5V93_RS13665 (J5V93_13665) - 2694547..2698395 (-) 3849 WP_215563491.1 phage tail tape measure protein -
  J5V93_RS13670 (J5V93_13670) - 2698411..2698587 (-) 177 WP_215563492.1 hypothetical protein -
  J5V93_RS13675 (J5V93_13675) - 2698617..2698934 (-) 318 WP_215563493.1 hypothetical protein -
  J5V93_RS13680 (J5V93_13680) - 2698983..2699591 (-) 609 WP_215563494.1 major tail protein -
  J5V93_RS13685 (J5V93_13685) - 2699592..2699951 (-) 360 WP_215563495.1 DUF3168 domain-containing protein -
  J5V93_RS13690 (J5V93_13690) - 2699948..2700382 (-) 435 WP_215563496.1 HK97-gp10 family putative phage morphogenesis protein -
  J5V93_RS13695 (J5V93_13695) - 2700375..2700698 (-) 324 WP_215563497.1 phage head closure protein -
  J5V93_RS13700 (J5V93_13700) - 2700703..2700954 (-) 252 WP_098133325.1 head-tail connector protein -
  J5V93_RS13705 (J5V93_13705) - 2700967..2701269 (-) 303 WP_215563498.1 fibronectin type III domain-containing protein -
  J5V93_RS13710 (J5V93_13710) - 2701247..2702443 (-) 1197 WP_215563499.1 phage major capsid protein -
  J5V93_RS13715 (J5V93_13715) - 2702440..2703204 (-) 765 WP_235713479.1 head maturation protease, ClpP-related -
  J5V93_RS13720 (J5V93_13720) - 2703182..2704399 (-) 1218 WP_215563500.1 phage portal protein -
  J5V93_RS13725 (J5V93_13725) - 2704423..2706150 (-) 1728 WP_215563501.1 terminase large subunit -
  J5V93_RS13730 (J5V93_13730) - 2706131..2706514 (-) 384 WP_215563502.1 phage terminase small subunit P27 family -
  J5V93_RS13735 (J5V93_13735) - 2706723..2706947 (-) 225 WP_215563503.1 hypothetical protein -
  J5V93_RS13740 (J5V93_13740) - 2706961..2707317 (-) 357 WP_215563504.1 HNH endonuclease signature motif containing protein -
  J5V93_RS13745 (J5V93_13745) - 2707332..2707586 (-) 255 WP_215563505.1 hypothetical protein -
  J5V93_RS13750 (J5V93_13750) - 2707601..2707846 (-) 246 WP_215564480.1 hypothetical protein -
  J5V93_RS13755 (J5V93_13755) - 2708253..2709701 (+) 1449 WP_215563506.1 HEPN domain-containing protein -
  J5V93_RS13760 (J5V93_13760) - 2709979..2710521 (-) 543 WP_215563507.1 tyrosine-type recombinase/integrase -
  J5V93_RS13765 (J5V93_13765) - 2710518..2710988 (-) 471 WP_098776110.1 ArpU family phage packaging/lysis transcriptional regulator -
  J5V93_RS13770 (J5V93_13770) - 2711009..2711179 (-) 171 WP_098776111.1 hypothetical protein -
  J5V93_RS13775 (J5V93_13775) - 2711332..2711415 (-) 84 Protein_2736 DUF3983 domain-containing protein -
  J5V93_RS13780 (J5V93_13780) - 2711434..2711607 (-) 174 WP_215563508.1 hypothetical protein -
  J5V93_RS30735 - 2711652..2711780 (-) 129 WP_265328834.1 hypothetical protein -
  J5V93_RS13785 (J5V93_13785) - 2711764..2712153 (-) 390 WP_235713480.1 hypothetical protein -
  J5V93_RS13790 (J5V93_13790) - 2712464..2712676 (-) 213 WP_235713504.1 hypothetical protein -
  J5V93_RS13795 (J5V93_13795) - 2712704..2712955 (-) 252 WP_215563509.1 helix-turn-helix domain containing protein -
  J5V93_RS13800 (J5V93_13800) - 2712981..2713145 (-) 165 WP_215563510.1 DUF3954 domain-containing protein -
  J5V93_RS13805 (J5V93_13805) - 2713164..2713523 (-) 360 WP_215563511.1 cell division protein SepF -
  J5V93_RS13810 (J5V93_13810) abrB 2713516..2713794 (-) 279 WP_215563512.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10027.52 Da        Isoelectric Point: 5.1584

>NTDB_id=550331 J5V93_RS13810 WP_215563512.1 2713516..2713794(-) (abrB) [Bacillus mycoides strain JAS06/1]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSESNLELLGGRMYLSKDGASEL
LDLLEKSGMVNA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=550331 J5V93_RS13810 WP_215563512.1 2713516..2713794(-) (abrB) [Bacillus mycoides strain JAS06/1]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACCGCACTAGACTTTCATGTTGATGGGGAAAATATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCCGAATCAAACTTGGAATTGTTGGGCGGTCGGATGTATTTGAGTAAGGATGGGGCAAGTGAGTTA
CTGGACCTTCTTGAGAAGAGTGGGATGGTAAATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

61.446

90.217

0.554